Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK(toxin) |
Location | 2309277..2309913 | Replicon | chromosome |
Accession | NZ_CP112996 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2018/0565 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | P0CL62 |
Locus tag | ORO19_RS10780 | Protein ID | WP_003410654.1 |
Coordinates | 2309503..2309913 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | P9WJ84 |
Locus tag | ORO19_RS10775 | Protein ID | WP_003410651.1 |
Coordinates | 2309277..2309510 (+) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO19_RS10760 (ORO19_10760) | 2304725..2305126 | + | 402 | WP_009937711.1 | metal ABC transporter permease | - |
ORO19_RS10765 (ORO19_10765) | 2305127..2305531 | - | 405 | WP_003410645.1 | PPOX class F420-dependent oxidoreductase | - |
ORO19_RS10770 (ORO19_10770) | 2305615..2309199 | - | 3585 | WP_010950652.1 | cobaltochelatase subunit CobN | - |
ORO19_RS10775 (ORO19_10775) | 2309277..2309510 | + | 234 | WP_003410651.1 | type II toxin-antitoxin system antitoxin MazE7 | Antitoxin |
ORO19_RS10780 (ORO19_10780) | 2309503..2309913 | + | 411 | WP_003410654.1 | type II toxin-antitoxin system toxin endoribonuclease MazF7 | Toxin |
ORO19_RS10785 (ORO19_10785) | 2309897..2310988 | + | 1092 | WP_003900454.1 | precorrin-3B synthase | - |
ORO19_RS10790 (ORO19_10790) | 2310998..2311622 | + | 625 | Protein_2133 | precorrin-8X methylmutase | - |
ORO19_RS10795 (ORO19_10795) | 2311619..2313145 | + | 1527 | WP_003410659.1 | precorrin-2 C(20)-methyltransferase | - |
ORO19_RS10800 (ORO19_10800) | 2313091..2314314 | - | 1224 | WP_003901321.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 14235.42 Da Isoelectric Point: 10.6228
>T265019 WP_003410654.1 NZ_CP112996:2309503-2309913 [Mycobacterium tuberculosis variant bovis]
MAEPRRGDLWLVSLGAARAGEPGKHRPAVVVSVDELLTGIDDELVVVVPVSSSRSRTPLRPPVAPSEGVAADSVAVCRGV
RAVARARLVERLGALKPATMRAIENALTLILGLPTGPERGEAATHSPVRWTGGRDP
MAEPRRGDLWLVSLGAARAGEPGKHRPAVVVSVDELLTGIDDELVVVVPVSSSRSRTPLRPPVAPSEGVAADSVAVCRGV
RAVARARLVERLGALKPATMRAIENALTLILGLPTGPERGEAATHSPVRWTGGRDP
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|