Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 2241492..2242118 | Replicon | chromosome |
Accession | NZ_CP112996 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2018/0565 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P64926 |
Locus tag | ORO19_RS10490 | Protein ID | WP_003410075.1 |
Coordinates | 2241720..2242118 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | ORO19_RS10485 | Protein ID | WP_019283586.1 |
Coordinates | 2241492..2241719 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO19_RS10475 (ORO19_10475) | 2239531..2239875 | - | 345 | WP_003410065.1 | ferredoxin family protein | - |
ORO19_RS10480 (ORO19_10480) | 2240064..2241233 | - | 1170 | WP_003899126.1 | ATP-binding protein | - |
ORO19_RS10485 (ORO19_10485) | 2241492..2241719 | + | 228 | WP_019283586.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
ORO19_RS10490 (ORO19_10490) | 2241720..2242118 | + | 399 | WP_003410075.1 | PIN domain nuclease | Toxin |
ORO19_RS10495 (ORO19_10495) | 2242301..2242732 | - | 432 | WP_003410078.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
ORO19_RS10500 (ORO19_10500) | 2242881..2243267 | + | 387 | WP_003899128.1 | DUF1398 domain-containing protein | - |
ORO19_RS10505 (ORO19_10505) | 2243704..2243883 | - | 180 | Protein_2076 | hypothetical protein | - |
ORO19_RS10510 (ORO19_10510) | 2243971..2244591 | + | 621 | WP_043856400.1 | IS110 family transposase | - |
ORO19_RS10515 (ORO19_10515) | 2244545..2245135 | + | 591 | WP_043856401.1 | IS110 family transposase | - |
ORO19_RS10520 (ORO19_10520) | 2245263..2246519 | - | 1257 | WP_010950642.1 | HNH endonuclease signature motif containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14731.02 Da Isoelectric Point: 6.7067
>T265017 WP_003410075.1 NZ_CP112996:2241720-2242118 [Mycobacterium tuberculosis variant bovis]
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|