Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mbcAT/RES-TIGR02293 |
Location | 2216186..2217084 | Replicon | chromosome |
Accession | NZ_CP112996 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2018/0565 |
Toxin (Protein)
Gene name | mbcT | Uniprot ID | P64908 |
Locus tag | ORO19_RS10365 | Protein ID | WP_003410001.1 |
Coordinates | 2216186..2216746 (-) | Length | 187 a.a. |
Antitoxin (Protein)
Gene name | mbcA | Uniprot ID | P64910 |
Locus tag | ORO19_RS10370 | Protein ID | WP_003410003.1 |
Coordinates | 2216743..2217084 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO19_RS10335 (ORO19_10335) | 2211355..2212008 | - | 654 | WP_003409976.1 | cutinase Cfp21 | - |
ORO19_RS10340 (ORO19_10340) | 2212123..2212353 | + | 231 | WP_003409980.1 | DUF167 domain-containing protein | - |
ORO19_RS10345 (ORO19_10345) | 2212438..2213349 | - | 912 | WP_003409986.1 | ArgP/LysG family DNA-binding transcriptional regulator | - |
ORO19_RS10350 (ORO19_10350) | 2213458..2214057 | + | 600 | WP_003409989.1 | L-lysine exporter | - |
ORO19_RS10355 (ORO19_10355) | 2214473..2214901 | + | 429 | WP_003409992.1 | cellulose-binding protein | - |
ORO19_RS10360 (ORO19_10360) | 2215127..2215666 | + | 540 | WP_031702531.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(37) | - |
ORO19_RS10365 (ORO19_10365) | 2216186..2216746 | - | 561 | WP_003410001.1 | RES family NAD+ phosphorylase | Toxin |
ORO19_RS10370 (ORO19_10370) | 2216743..2217084 | - | 342 | WP_003410003.1 | DUF2384 domain-containing protein | Antitoxin |
ORO19_RS10375 (ORO19_10375) | 2217170..2217427 | + | 258 | WP_003410006.1 | hypothetical protein | - |
ORO19_RS10380 (ORO19_10380) | 2217328..2217663 | - | 336 | WP_003410009.1 | dehydrogenase | - |
ORO19_RS10385 (ORO19_10385) | 2217752..2218096 | - | 345 | WP_003410010.1 | type II toxin-antitoxin system toxin endoribonuclease MazF6 | - |
ORO19_RS10390 (ORO19_10390) | 2218090..2218338 | - | 249 | WP_003410014.1 | ribbon-helix-helix protein, CopG family | - |
ORO19_RS10395 (ORO19_10395) | 2218438..2220753 | - | 2316 | WP_003899120.1 | cation transporter ATPase CptG | - |
ORO19_RS10400 (ORO19_10400) | 2220750..2221022 | - | 273 | WP_003410017.1 | DUF1490 family protein | - |
ORO19_RS10405 (ORO19_10405) | 2221075..2221431 | - | 357 | WP_003410018.1 | Cd(II)/Pb(II)-sensing metalloregulatory transcriptional regulator CmtR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 187 a.a. Molecular weight: 20248.70 Da Isoelectric Point: 4.5091
>T265015 WP_003410001.1 NZ_CP112996:c2216746-2216186 [Mycobacterium tuberculosis variant bovis]
VSDALDEGLVQRIDARGTIEWSETCYRYTGAHRDALSGEGARRFGGRWNPPLLFPAIYLADSAQACMVEVERAAQAASTT
AEKMLEAAYRLHTIDVTDLAVLDLTTPQAREAVGLENDDIYGDDWSGCQAVGHAAWFLHMQGVLVPAAGGVGLVVTAYEQ
RTRPGQLQLRQSVDLTPALYQELRAT
VSDALDEGLVQRIDARGTIEWSETCYRYTGAHRDALSGEGARRFGGRWNPPLLFPAIYLADSAQACMVEVERAAQAASTT
AEKMLEAAYRLHTIDVTDLAVLDLTTPQAREAVGLENDDIYGDDWSGCQAVGHAAWFLHMQGVLVPAAGGVGLVVTAYEQ
RTRPGQLQLRQSVDLTPALYQELRAT
Download Length: 561 bp
Antitoxin
Download Length: 114 a.a. Molecular weight: 12488.33 Da Isoelectric Point: 4.8359
>AT265015 WP_003410003.1 NZ_CP112996:c2217084-2216743 [Mycobacterium tuberculosis variant bovis]
MGVNVLASTVSGAIERLGLTYEEVGDIVDASPRSVARWTAGQVVPQRLNKQRLIELAYVADALAEVLPRDQANVWMFSPN
RLLEHRKPADLVRDGEYQRVLALIDAMAEGVFV
MGVNVLASTVSGAIERLGLTYEEVGDIVDASPRSVARWTAGQVVPQRLNKQRLIELAYVADALAEVLPRDQANVWMFSPN
RLLEHRKPADLVRDGEYQRVLALIDAMAEGVFV
Download Length: 342 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6FKG |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6FKG | |
AlphaFold DB | A0A7U4FAE4 |