Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 2208860..2209548 | Replicon | chromosome |
Accession | NZ_CP112996 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2018/0565 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P0A653 |
Locus tag | ORO19_RS10320 | Protein ID | WP_003409958.1 |
Coordinates | 2208860..2209279 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ28 |
Locus tag | ORO19_RS10325 | Protein ID | WP_003409968.1 |
Coordinates | 2209288..2209548 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO19_RS10290 (ORO19_10290) | 2203866..2204171 | + | 306 | Protein_2033 | ABC transporter permease | - |
ORO19_RS10295 (ORO19_10295) | 2204167..2204247 | + | 81 | Protein_2034 | hypothetical protein | - |
ORO19_RS10300 (ORO19_10300) | 2204355..2205203 | + | 849 | WP_010950638.1 | class I SAM-dependent methyltransferase | - |
ORO19_RS10305 (ORO19_10305) | 2205166..2206611 | - | 1446 | WP_003409946.1 | APC family permease | - |
ORO19_RS10310 (ORO19_10310) | 2206790..2207476 | - | 687 | WP_003409954.1 | immunoprotective protein Mpt64 | - |
ORO19_RS10315 (ORO19_10315) | 2207667..2208635 | - | 969 | WP_003409956.1 | class 1b ribonucleoside-diphosphate reductase subunit beta | - |
ORO19_RS10320 (ORO19_10320) | 2208860..2209279 | - | 420 | WP_003409958.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
ORO19_RS10325 (ORO19_10325) | 2209288..2209548 | - | 261 | WP_003409968.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
ORO19_RS10330 (ORO19_10330) | 2209691..2211367 | + | 1677 | WP_010950639.1 | PecA family PE domain-processing aspartic protease | - |
ORO19_RS10335 (ORO19_10335) | 2211355..2212008 | - | 654 | WP_003409976.1 | cutinase Cfp21 | - |
ORO19_RS10340 (ORO19_10340) | 2212123..2212353 | + | 231 | WP_003409980.1 | DUF167 domain-containing protein | - |
ORO19_RS10345 (ORO19_10345) | 2212438..2213349 | - | 912 | WP_003409986.1 | ArgP/LysG family DNA-binding transcriptional regulator | - |
ORO19_RS10350 (ORO19_10350) | 2213458..2214057 | + | 600 | WP_003409989.1 | L-lysine exporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14724.89 Da Isoelectric Point: 7.9535
>T265014 WP_003409958.1 NZ_CP112996:c2209279-2208860 [Mycobacterium tuberculosis variant bovis]
MIVDTSAVVALVQGERPHATLVAAALAGAHSPVMSAPTVAECLIVLTARHGPVARTIFERLRSEIGLSVSSFTAEHAAAT
QRAFLRYGKGRHRAALNFGDCMTYATAQLGHQPLLAVGNDFPQTDLEFRGVVGYWPGVA
MIVDTSAVVALVQGERPHATLVAAALAGAHSPVMSAPTVAECLIVLTARHGPVARTIFERLRSEIGLSVSSFTAEHAAAT
QRAFLRYGKGRHRAALNFGDCMTYATAQLGHQPLLAVGNDFPQTDLEFRGVVGYWPGVA
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829C4H9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829C483 |