Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 1957568..1958028 | Replicon | chromosome |
Accession | NZ_CP112996 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2018/0565 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A7U4FB26 |
Locus tag | ORO19_RS09160 | Protein ID | WP_003408531.1 |
Coordinates | 1957780..1958028 (+) | Length | 83 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ30 |
Locus tag | ORO19_RS09155 | Protein ID | WP_003408528.1 |
Coordinates | 1957568..1957780 (+) | Length | 71 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO19_RS09140 (ORO19_09140) | 1954046..1955233 | - | 1188 | WP_003898992.1 | nitrate transporter NarK | - |
ORO19_RS09145 (ORO19_09145) | 1955520..1955804 | + | 285 | WP_003408522.1 | DUF1876 domain-containing protein | - |
ORO19_RS09150 (ORO19_09150) | 1955818..1957500 | - | 1683 | WP_003898994.1 | SulP family inorganic anion transporter | - |
ORO19_RS09155 (ORO19_09155) | 1957568..1957780 | + | 213 | WP_003408528.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
ORO19_RS09160 (ORO19_09160) | 1957780..1958028 | + | 249 | WP_003408531.1 | hypothetical protein | Toxin |
ORO19_RS09165 (ORO19_09165) | 1958036..1958774 | + | 739 | Protein_1808 | hypothetical protein | - |
ORO19_RS09170 (ORO19_09170) | 1958868..1960568 | + | 1701 | WP_003898998.1 | serine/threonine protein kinase PknE | - |
ORO19_RS09175 (ORO19_09175) | 1960853..1961254 | - | 402 | WP_010950586.1 | hypothetical protein | - |
ORO19_RS09180 (ORO19_09180) | 1961244..1961855 | - | 612 | Protein_1811 | isopentenyl-diphosphate Delta-isomerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 83 a.a. Molecular weight: 8857.07 Da Isoelectric Point: 3.9794
>T265010 WP_003408531.1 NZ_CP112996:1957780-1958028 [Mycobacterium tuberculosis variant bovis]
MVIDTSALVAMLNDEPEAQRFEIAVAADHVWLMSTASYPEMATVIETRFGEPGGREPKVSGQPLLYTGDDFACIDIRAVL
AG
MVIDTSALVAMLNDEPEAQRFEIAVAADHVWLMSTASYPEMATVIETRFGEPGGREPKVSGQPLLYTGDDFACIDIRAVL
AG
Download Length: 249 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FB26 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CFE8 |