Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 1936836..1937449 | Replicon | chromosome |
Accession | NZ_CP112996 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2018/0565 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WFA2 |
Locus tag | ORO19_RS09050 | Protein ID | WP_003408465.1 |
Coordinates | 1936836..1937225 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ52 |
Locus tag | ORO19_RS09055 | Protein ID | WP_003408469.1 |
Coordinates | 1937222..1937449 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO19_RS09015 (ORO19_09015) | 1932466..1933380 | + | 915 | WP_003898985.1 | 3-hydroxyacyl-CoA dehydrogenase family protein | - |
ORO19_RS09020 (ORO19_09020) | 1933383..1934213 | + | 831 | WP_003408448.1 | cyclase family protein | - |
ORO19_RS09025 (ORO19_09025) | 1934213..1934563 | + | 351 | WP_003898986.1 | cupin domain-containing protein | - |
ORO19_RS09030 (ORO19_09030) | 1934616..1935433 | + | 818 | Protein_1782 | 3-keto-5-aminohexanoate cleavage protein | - |
ORO19_RS09035 (ORO19_09035) | 1935447..1936226 | + | 780 | WP_003408460.1 | IclR family transcriptional regulator | - |
ORO19_RS09045 (ORO19_09045) | 1936657..1936788 | + | 132 | Protein_1784 | IS3 family transposase | - |
ORO19_RS09050 (ORO19_09050) | 1936836..1937225 | - | 390 | WP_003408465.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
ORO19_RS09055 (ORO19_09055) | 1937222..1937449 | - | 228 | WP_003408469.1 | antitoxin | Antitoxin |
ORO19_RS09060 (ORO19_09060) | 1937667..1939151 | + | 1485 | WP_010950580.1 | biotin carboxylase | - |
ORO19_RS09065 (ORO19_09065) | 1939148..1940395 | + | 1248 | WP_003408476.1 | serine hydrolase | - |
ORO19_RS09070 (ORO19_09070) | 1940438..1940857 | - | 420 | WP_003408483.1 | hypothetical protein | - |
ORO19_RS09075 (ORO19_09075) | 1940847..1941557 | - | 711 | WP_003408486.1 | winged helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 13817.98 Da Isoelectric Point: 7.0612
>T265009 WP_003408465.1 NZ_CP112996:c1937225-1936836 [Mycobacterium tuberculosis variant bovis]
VIVLDASAAVELMLTTPAGAAVARRLRGETVHAPAHFDVEVIGAIRQAVVRQLISDHEGLVVVVNFLSLPVRRWPLKPFT
QRAYQLRSTHTVADGAYVALAEGLGVPLITCDGRLAQSHGHNAEIELVA
VIVLDASAAVELMLTTPAGAAVARRLRGETVHAPAHFDVEVIGAIRQAVVRQLISDHEGLVVVVNFLSLPVRRWPLKPFT
QRAYQLRSTHTVADGAYVALAEGLGVPLITCDGRLAQSHGHNAEIELVA
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BUI9 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7E4J | |
AlphaFold DB | A0A7U4FAN9 |