Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1687483..1688099 | Replicon | chromosome |
Accession | NZ_CP112996 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2018/0565 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G0TJ74 |
Locus tag | ORO19_RS07950 | Protein ID | WP_003407593.1 |
Coordinates | 1687782..1688099 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G0TJ73 |
Locus tag | ORO19_RS07945 | Protein ID | WP_003900349.1 |
Coordinates | 1687483..1687785 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO19_RS07935 (ORO19_07935) | 1683369..1685216 | + | 1848 | WP_003407585.1 | methylmalonyl-CoA mutase small subunit | - |
ORO19_RS07940 (ORO19_07940) | 1685217..1687469 | + | 2253 | WP_003407587.1 | methylmalonyl-CoA mutase | - |
ORO19_RS07945 (ORO19_07945) | 1687483..1687785 | + | 303 | WP_003900349.1 | type II toxin-antitoxin system antitoxin MazE4 | Antitoxin |
ORO19_RS07950 (ORO19_07950) | 1687782..1688099 | + | 318 | WP_003407593.1 | type II toxin-antitoxin system toxin endoribonuclease MazF4 | Toxin |
ORO19_RS07955 (ORO19_07955) | 1688096..1689100 | + | 1005 | WP_003407596.1 | methylmalonyl Co-A mutase-associated GTPase MeaB | - |
ORO19_RS07960 (ORO19_07960) | 1689153..1690442 | + | 1290 | WP_003407599.1 | serine hydrolase domain-containing protein | - |
ORO19_RS07965 (ORO19_07965) | 1690515..1691240 | - | 726 | WP_003898898.1 | class I SAM-dependent methyltransferase | - |
ORO19_RS07970 (ORO19_07970) | 1691346..1691537 | - | 192 | WP_003407609.1 | dodecin family protein | - |
ORO19_RS07975 (ORO19_07975) | 1691619..1692017 | + | 399 | WP_003900351.1 | hypothetical protein | - |
ORO19_RS07980 (ORO19_07980) | 1692062..1693090 | + | 1029 | WP_003407612.1 | glycosyltransferase family 2 protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11377.97 Da Isoelectric Point: 7.9950
>T265007 WP_003407593.1 NZ_CP112996:1687782-1688099 [Mycobacterium tuberculosis variant bovis]
VNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDY
LGEVTPATMNKINTALATALGLPWP
VNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDY
LGEVTPATMNKINTALATALGLPWP
Download Length: 318 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11173.42 Da Isoelectric Point: 9.5564
>AT265007 WP_003900349.1 NZ_CP112996:1687483-1687785 [Mycobacterium tuberculosis variant bovis]
VPFLVALSGIISGVRDHSMTVRLDQQTRQRLQDIVKGGYRSANAAIVDAINKRWEALHDEQLDAAYAAAIHDNPAYPYES
EAERSAARARRNARQQRSAQ
VPFLVALSGIISGVRDHSMTVRLDQQTRQRLQDIVKGGYRSANAAIVDAINKRWEALHDEQLDAAYAAAIHDNPAYPYES
EAERSAARARRNARQQRSAQ
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|