Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | unclassified/Polyketide_cyc2(toxin) |
Location | 1015207..1015826 | Replicon | chromosome |
Accession | NZ_CP112996 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2018/0565 |
Toxin (Protein)
Gene name | novel[antitoxin] | Uniprot ID | - |
Locus tag | ORO19_RS04825 | Protein ID | WP_003404726.1 |
Coordinates | 1015392..1015826 (+) | Length | 145 a.a. |
Antitoxin (Protein)
Gene name | novel[toxin] | Uniprot ID | G0TFQ5 |
Locus tag | ORO19_RS04820 | Protein ID | WP_003404724.1 |
Coordinates | 1015207..1015386 (+) | Length | 60 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO19_RS04805 (ORO19_04805) | 1010680..1012260 | + | 1581 | WP_011799139.1 | serine hydrolase | - |
ORO19_RS04810 (ORO19_04810) | 1012257..1014650 | + | 2394 | WP_003898639.1 | cation-translocating P-type ATPase | - |
ORO19_RS04815 (ORO19_04815) | 1014923..1015081 | + | 159 | WP_003404720.1 | hypothetical protein | - |
ORO19_RS04820 (ORO19_04820) | 1015207..1015386 | + | 180 | WP_003404724.1 | antitoxin | Antitoxin |
ORO19_RS04825 (ORO19_04825) | 1015392..1015826 | + | 435 | WP_003404726.1 | SRPBCC family protein | Toxin |
ORO19_RS04830 (ORO19_04830) | 1015924..1016697 | + | 774 | WP_003404735.1 | VOC family protein | - |
ORO19_RS04835 (ORO19_04835) | 1016762..1017211 | + | 450 | WP_003404738.1 | hypothetical protein | - |
ORO19_RS04840 (ORO19_04840) | 1017346..1017576 | - | 231 | WP_003898642.1 | hypothetical protein | - |
ORO19_RS04845 (ORO19_04845) | 1017743..1019251 | - | 1509 | WP_010950467.1 | carotenoid oxygenase family protein | - |
ORO19_RS04850 (ORO19_04850) | 1019253..1020491 | - | 1239 | WP_003404744.1 | acetyl-CoA acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15754.47 Da Isoelectric Point: 9.7977
>T264998 WP_003404726.1 NZ_CP112996:1015392-1015826 [Mycobacterium tuberculosis variant bovis]
MAKLSGSIDVPLPPEEAWMHASDLTRYREWLTIHKVWRSKLPEVLEKGTVVESYVEVKGMPNRIKWTIVRYKPPEGMTLN
GDGVGGVKVKLIAKVAPKEHGSVVSFDVHLGGPALLGPIGMIVAAALRADIRESLQNFVTVFAG
MAKLSGSIDVPLPPEEAWMHASDLTRYREWLTIHKVWRSKLPEVLEKGTVVESYVEVKGMPNRIKWTIVRYKPPEGMTLN
GDGVGGVKVKLIAKVAPKEHGSVVSFDVHLGGPALLGPIGMIVAAALRADIRESLQNFVTVFAG
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|