Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 843039..843748 | Replicon | chromosome |
Accession | NZ_CP112996 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2018/0565 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WF74 |
Locus tag | ORO19_RS03985 | Protein ID | WP_003403837.1 |
Coordinates | 843320..843748 (+) | Length | 143 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TEX4 |
Locus tag | ORO19_RS03980 | Protein ID | WP_003403834.1 |
Coordinates | 843039..843296 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO19_RS03975 (ORO19_03975) | 840219..842948 | + | 2730 | WP_010950437.1 | PE family protein | - |
ORO19_RS03980 (ORO19_03980) | 843039..843296 | + | 258 | WP_003403834.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
ORO19_RS03985 (ORO19_03985) | 843320..843748 | + | 429 | WP_003403837.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
ORO19_RS03990 (ORO19_03990) | 843829..843966 | - | 138 | WP_003403839.1 | hypothetical protein | - |
ORO19_RS03995 (ORO19_03995) | 844125..844370 | + | 246 | WP_003403841.1 | hypothetical protein | - |
ORO19_RS04000 (ORO19_04000) | 844439..845323 | - | 885 | WP_003403844.1 | 3-hydroxyisobutyrate dehydrogenase | - |
ORO19_RS04005 (ORO19_04005) | 845334..846506 | - | 1173 | WP_010950438.1 | acyl-CoA dehydrogenase family protein | - |
ORO19_RS04010 (ORO19_04010) | 846513..848045 | - | 1533 | WP_010950439.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15831.27 Da Isoelectric Point: 7.5536
>T264997 WP_003403837.1 NZ_CP112996:843320-843748 [Mycobacterium tuberculosis variant bovis]
MFLLDANVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWASFLRLATNRRIFEIPSPRAEAFAFVEAVTAQPHHL
PTNPGPRHLMLLRKLCDEADASGDLIPDAVLAAIAVGHHCAVVSLDRDFARFASVRHIRPPL
MFLLDANVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWASFLRLATNRRIFEIPSPRAEAFAFVEAVTAQPHHL
PTNPGPRHLMLLRKLCDEADASGDLIPDAVLAAIAVGHHCAVVSLDRDFARFASVRHIRPPL
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CDR3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TEX4 |