Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF(toxin)
Location 756357..756897 Replicon chromosome
Accession NZ_CP112996
Organism Mycobacterium tuberculosis variant bovis strain 2018/0565

Toxin (Protein)


Gene name mazF Uniprot ID P9WII0
Locus tag ORO19_RS03495 Protein ID WP_003403376.1
Coordinates 756357..756665 (-) Length 103 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID G0TQE0
Locus tag ORO19_RS03500 Protein ID WP_003403381.1
Coordinates 756652..756897 (-) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORO19_RS03470 (ORO19_03470) 751672..753177 + 1506 WP_003403360.1 carotenoid cleavage oxygenase -
ORO19_RS03475 (ORO19_03475) 753258..754268 + 1011 WP_003911248.1 ABC transporter ATP-binding protein -
ORO19_RS03480 (ORO19_03480) 754656..755039 - 384 WP_003403365.1 ribonuclease VapC6 -
ORO19_RS03485 (ORO19_03485) 755134..755289 - 156 WP_003403368.1 type II toxin-antitoxin system VapB family antitoxin -
ORO19_RS03490 (ORO19_03490) 755365..756081 - 717 WP_003403371.1 CPBP family intramembrane metalloprotease -
ORO19_RS03495 (ORO19_03495) 756357..756665 - 309 WP_003403376.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
ORO19_RS03500 (ORO19_03500) 756652..756897 - 246 WP_003403381.1 ribbon-helix-helix protein, CopG family Antitoxin
ORO19_RS03505 (ORO19_03505) 757007..757444 - 438 WP_003403386.1 type II toxin-antitoxin system VapC family toxin -
ORO19_RS03510 (ORO19_03510) 757441..757695 - 255 WP_003911263.1 antitoxin VapB7 -
ORO19_RS03515 (ORO19_03515) 757809..760172 + 2364 WP_031702437.1 arylsulfatase AtsD -
ORO19_RS03520 (ORO19_03520) 760235..760561 + 327 WP_003403401.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
ORO19_RS03525 (ORO19_03525) 760473..760811 + 339 WP_003403405.1 PIN domain-containing protein -
ORO19_RS03530 (ORO19_03530) 760808..760981 + 174 WP_003898549.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(1-101)

Antitoxin

Ribbon-helix-helix protein, CopG

(2-38)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11320.10 Da        Isoelectric Point: 11.6554

>T264994 WP_003403376.1 NZ_CP112996:c756665-756357 [Mycobacterium tuberculosis variant bovis]
MRRGELWFAATPGGDRPVLVLTRDPVADRIGAVVVVALTRTRRGLVSELELTAVENRVPSDCVVNFDNIHTLPRTAFRRR
ITRLSPARLHEACQTLRASTGC

Download         Length: 309 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 9169.01 Da        Isoelectric Point: 4.2070

>AT264994 WP_003403381.1 NZ_CP112996:c756897-756652 [Mycobacterium tuberculosis variant bovis]
MLSFRADDHDVDLADAWARRLHIGRSELLRDALRRHLAALAADQDVQAYTERPLTDDENALAEIADWGPAEDWADWADAA
R

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4BSE5

Antitoxin

Source ID Structure
AlphaFold DB G0TQE0

References