Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 754656..755289 Replicon chromosome
Accession NZ_CP112996
Organism Mycobacterium tuberculosis variant bovis strain 2018/0565

Toxin (Protein)


Gene name vapC Uniprot ID G0TQD6
Locus tag ORO19_RS03480 Protein ID WP_003403365.1
Coordinates 754656..755039 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P9WJ56
Locus tag ORO19_RS03485 Protein ID WP_003403368.1
Coordinates 755134..755289 (-) Length 52 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORO19_RS03455 (ORO19_03455) 749948..750484 + 537 WP_003403341.1 50S ribosomal protein L10 -
ORO19_RS03460 (ORO19_03460) 750521..750913 + 393 WP_003403353.1 50S ribosomal protein L7/L12 -
ORO19_RS03465 (ORO19_03465) 750906..751601 - 696 WP_003403355.1 TetR/AcrR family transcriptional regulator -
ORO19_RS03470 (ORO19_03470) 751672..753177 + 1506 WP_003403360.1 carotenoid cleavage oxygenase -
ORO19_RS03475 (ORO19_03475) 753258..754268 + 1011 WP_003911248.1 ABC transporter ATP-binding protein -
ORO19_RS03480 (ORO19_03480) 754656..755039 - 384 WP_003403365.1 ribonuclease VapC6 Toxin
ORO19_RS03485 (ORO19_03485) 755134..755289 - 156 WP_003403368.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
ORO19_RS03490 (ORO19_03490) 755365..756081 - 717 WP_003403371.1 CPBP family intramembrane metalloprotease -
ORO19_RS03495 (ORO19_03495) 756357..756665 - 309 WP_003403376.1 type II toxin-antitoxin system PemK/MazF family toxin -
ORO19_RS03500 (ORO19_03500) 756652..756897 - 246 WP_003403381.1 ribbon-helix-helix protein, CopG family -
ORO19_RS03505 (ORO19_03505) 757007..757444 - 438 WP_003403386.1 type II toxin-antitoxin system VapC family toxin -
ORO19_RS03510 (ORO19_03510) 757441..757695 - 255 WP_003911263.1 antitoxin VapB7 -
ORO19_RS03515 (ORO19_03515) 757809..760172 + 2364 WP_031702437.1 arylsulfatase AtsD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Bacterial antitoxin of type II TA system, VapB

(3-44)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 13959.73 Da        Isoelectric Point: 6.0803

>T264993 WP_003403365.1 NZ_CP112996:c755039-754656 [Mycobacterium tuberculosis variant bovis]
MAAATTTGTHRGLELRAAQRAVGSCEPQRAEFCRSARNADEFDQMSRMFGDVYPDVPVPKSVWRWIDSAQHRLARAGAVG
ALSVVDLLICDTAAARGLVVLHDDADYELAERHLPDIRVRRVVSADD

Download         Length: 384 bp

Antitoxin


Download         Length: 52 a.a.        Molecular weight: 5872.72 Da        Isoelectric Point: 5.7734

>AT264993 WP_003403368.1 NZ_CP112996:c755289-755134 [Mycobacterium tuberculosis variant bovis]
VSVTQIDLDDEALADVMRIAAVHTKKEAVNLAMRDYVERFRRIEALARSRE

Download         Length: 156 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQD6

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BSF8

References