Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-PHD |
Location | 719174..719838 | Replicon | chromosome |
Accession | NZ_CP112996 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2018/0565 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P96917 |
Locus tag | ORO19_RS03310 | Protein ID | WP_003403246.1 |
Coordinates | 719431..719838 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WF18 |
Locus tag | ORO19_RS03305 | Protein ID | WP_003403244.1 |
Coordinates | 719174..719434 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO19_RS03280 (ORO19_03280) | 715351..716508 | + | 1158 | WP_003903091.1 | hypothetical protein | - |
ORO19_RS03285 (ORO19_03285) | 716519..717466 | + | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
ORO19_RS03290 (ORO19_03290) | 717559..717813 | + | 255 | WP_003403235.1 | type II toxin-antitoxin system antitoxin VapB30 | - |
ORO19_RS03295 (ORO19_03295) | 717813..718208 | + | 396 | WP_003403236.1 | type II toxin-antitoxin system toxin ribonuclease C30 | - |
ORO19_RS03300 (ORO19_03300) | 718302..719042 | - | 741 | WP_003403239.1 | TVP38/TMEM64 family protein | - |
ORO19_RS03305 (ORO19_03305) | 719174..719434 | + | 261 | WP_003403244.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
ORO19_RS03310 (ORO19_03310) | 719431..719838 | + | 408 | WP_003403246.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
ORO19_RS03315 (ORO19_03315) | 719910..721061 | - | 1152 | WP_003403248.1 | FIST N-terminal domain-containing protein | - |
ORO19_RS03320 (ORO19_03320) | 721154..722881 | - | 1728 | WP_010950423.1 | exodeoxyribonuclease V subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 14376.37 Da Isoelectric Point: 4.3568
>T264992 WP_003403246.1 NZ_CP112996:719431-719838 [Mycobacterium tuberculosis variant bovis]
VSTTPAAGVLDTSVFIATESGRQLDEALIPDRVATTVVTLAELRVGVLAAATTDIRAQRLATLESVADMETLPVDDDAAR
MWARLRIHLAESGRRVRINDLWIAAVAASRALPVITQDDDFAALDGAASVEIIRV
VSTTPAAGVLDTSVFIATESGRQLDEALIPDRVATTVVTLAELRVGVLAAATTDIRAQRLATLESVADMETLPVDDDAAR
MWARLRIHLAESGRRVRINDLWIAAVAASRALPVITQDDDFAALDGAASVEIIRV
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 3DBO |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 3DBO | |
AlphaFold DB | A0A7U4BSE4 |