Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 711930..712555 | Replicon | chromosome |
Accession | NZ_CP112996 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2018/0565 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQA0 |
Locus tag | ORO19_RS03260 | Protein ID | WP_003403218.1 |
Coordinates | 712154..712555 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ36 |
Locus tag | ORO19_RS03255 | Protein ID | WP_003403213.1 |
Coordinates | 711930..712157 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO19_RS03230 (ORO19_03230) | 707109..707330 | - | 222 | WP_003898525.1 | DUF4926 domain-containing protein | - |
ORO19_RS03235 (ORO19_03235) | 707472..708077 | + | 606 | WP_003898526.1 | hypothetical protein | - |
ORO19_RS03240 (ORO19_03240) | 708096..710663 | - | 2568 | WP_003900188.1 | SEC-C metal-binding domain-containing protein | - |
ORO19_RS03245 (ORO19_03245) | 710747..711496 | + | 750 | WP_003898528.1 | hypothetical protein | - |
ORO19_RS03250 (ORO19_03250) | 711493..711735 | + | 243 | WP_003403210.1 | hypothetical protein | - |
ORO19_RS03255 (ORO19_03255) | 711930..712157 | + | 228 | WP_003403213.1 | antitoxin VapB29 | Antitoxin |
ORO19_RS03260 (ORO19_03260) | 712154..712555 | + | 402 | WP_003403218.1 | type II toxin-antitoxin system ribonuclease VapC29 | Toxin |
ORO19_RS03265 (ORO19_03265) | 712684..712767 | + | 84 | Protein_647 | galactose-1-phosphate uridylyltransferase | - |
ORO19_RS03270 (ORO19_03270) | 712786..713868 | + | 1083 | WP_031702118.1 | galactose-1-phosphate uridylyltransferase | - |
ORO19_RS03275 (ORO19_03275) | 713865..714956 | + | 1092 | WP_003403225.1 | galactokinase | - |
ORO19_RS03280 (ORO19_03280) | 715351..716508 | + | 1158 | WP_003903091.1 | hypothetical protein | - |
ORO19_RS03285 (ORO19_03285) | 716519..717466 | + | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 13937.76 Da Isoelectric Point: 5.7441
>T264990 WP_003403218.1 NZ_CP112996:712154-712555 [Mycobacterium tuberculosis variant bovis]
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQA0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BSC9 |