Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 704392..705035 | Replicon | chromosome |
| Accession | NZ_CP112996 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain 2018/0565 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P67239 |
| Locus tag | ORO19_RS03210 | Protein ID | WP_003403187.1 |
| Coordinates | 704634..705035 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TQ91 |
| Locus tag | ORO19_RS03205 | Protein ID | WP_003403184.1 |
| Coordinates | 704392..704637 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORO19_RS03170 (ORO19_03170) | 699672..700202 | - | 531 | WP_003917320.1 | two component system sensor kinase HK2 | - |
| ORO19_RS03175 (ORO19_03175) | 700186..700881 | - | 696 | WP_197044064.1 | two-component system response regulator TcrA | - |
| ORO19_RS03180 (ORO19_03180) | 701004..701315 | + | 312 | WP_003403164.1 | hypothetical protein | - |
| ORO19_RS03185 (ORO19_03185) | 701387..702337 | + | 951 | WP_003907436.1 | DUF1259 domain-containing protein | - |
| ORO19_RS03190 (ORO19_03190) | 702578..703162 | + | 585 | WP_003403171.1 | IS607-like element IS1536 family transposase | - |
| ORO19_RS03195 (ORO19_03195) | 703164..703874 | + | 711 | Protein_633 | IS607 family element RNA-guided endonuclease TnpB | - |
| ORO19_RS03200 (ORO19_03200) | 703877..704347 | + | 471 | WP_003898523.1 | hypothetical protein | - |
| ORO19_RS03205 (ORO19_03205) | 704392..704637 | + | 246 | WP_003403184.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| ORO19_RS03210 (ORO19_03210) | 704634..705035 | + | 402 | WP_003403187.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| ORO19_RS03215 (ORO19_03215) | 705026..705205 | + | 180 | Protein_637 | hypothetical protein | - |
| ORO19_RS03220 (ORO19_03220) | 705623..705820 | - | 198 | WP_003403191.1 | hypothetical protein | - |
| ORO19_RS03225 (ORO19_03225) | 705900..707057 | - | 1158 | WP_003403193.1 | hypothetical protein | - |
| ORO19_RS03230 (ORO19_03230) | 707109..707330 | - | 222 | WP_003898525.1 | DUF4926 domain-containing protein | - |
| ORO19_RS03235 (ORO19_03235) | 707472..708077 | + | 606 | WP_003898526.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14501.21 Da Isoelectric Point: 4.4463
>T264989 WP_003403187.1 NZ_CP112996:704634-705035 [Mycobacterium tuberculosis variant bovis]
VIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLAR
AAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR
VIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLAR
AAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BSD6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQ91 |