Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC(toxin)
Location 704392..705035 Replicon chromosome
Accession NZ_CP112996
Organism Mycobacterium tuberculosis variant bovis strain 2018/0565

Toxin (Protein)


Gene name vapC Uniprot ID P67239
Locus tag ORO19_RS03210 Protein ID WP_003403187.1
Coordinates 704634..705035 (+) Length 134 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ91
Locus tag ORO19_RS03205 Protein ID WP_003403184.1
Coordinates 704392..704637 (+) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORO19_RS03170 (ORO19_03170) 699672..700202 - 531 WP_003917320.1 two component system sensor kinase HK2 -
ORO19_RS03175 (ORO19_03175) 700186..700881 - 696 WP_197044064.1 two-component system response regulator TcrA -
ORO19_RS03180 (ORO19_03180) 701004..701315 + 312 WP_003403164.1 hypothetical protein -
ORO19_RS03185 (ORO19_03185) 701387..702337 + 951 WP_003907436.1 DUF1259 domain-containing protein -
ORO19_RS03190 (ORO19_03190) 702578..703162 + 585 WP_003403171.1 IS607-like element IS1536 family transposase -
ORO19_RS03195 (ORO19_03195) 703164..703874 + 711 Protein_633 IS607 family element RNA-guided endonuclease TnpB -
ORO19_RS03200 (ORO19_03200) 703877..704347 + 471 WP_003898523.1 hypothetical protein -
ORO19_RS03205 (ORO19_03205) 704392..704637 + 246 WP_003403184.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
ORO19_RS03210 (ORO19_03210) 704634..705035 + 402 WP_003403187.1 type II toxin-antitoxin system VapC family toxin Toxin
ORO19_RS03215 (ORO19_03215) 705026..705205 + 180 Protein_637 hypothetical protein -
ORO19_RS03220 (ORO19_03220) 705623..705820 - 198 WP_003403191.1 hypothetical protein -
ORO19_RS03225 (ORO19_03225) 705900..707057 - 1158 WP_003403193.1 hypothetical protein -
ORO19_RS03230 (ORO19_03230) 707109..707330 - 222 WP_003898525.1 DUF4926 domain-containing protein -
ORO19_RS03235 (ORO19_03235) 707472..708077 + 606 WP_003898526.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(1-124)

Antitoxin

Antitoxin VapB-like

(1-80)


Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 14501.21 Da        Isoelectric Point: 4.4463

>T264989 WP_003403187.1 NZ_CP112996:704634-705035 [Mycobacterium tuberculosis variant bovis]
VIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLAR
AAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR

Download         Length: 402 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 8813.12 Da        Isoelectric Point: 10.3486

>AT264989 WP_003403184.1 NZ_CP112996:704392-704637 [Mycobacterium tuberculosis variant bovis]
MALNIKDPSVHQAVKQIAKITGESQARAVATAVNERLARLRSDDLAARLLAIGHKTASRMSPEAKRLDHDALLYDERGLP
A

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4BSD6

Antitoxin

Source ID Structure
AlphaFold DB G0TQ91

References