Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1-PHD
Location 695987..696633 Replicon chromosome
Accession NZ_CP112996
Organism Mycobacterium tuberculosis variant bovis strain 2018/0565

Toxin (Protein)


Gene name vapC Uniprot ID O07783
Locus tag ORO19_RS03140 Protein ID WP_003403122.1
Coordinates 695987..696379 (-) Length 131 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ86
Locus tag ORO19_RS03145 Protein ID WP_003403125.1
Coordinates 696376..696633 (-) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORO19_RS03125 (ORO19_03125) 691647..693175 + 1529 Protein_619 virulence factor Mce family protein -
ORO19_RS03130 (ORO19_03130) 693238..694380 + 1143 Protein_620 virulence factor Mce family protein -
ORO19_RS03135 (ORO19_03135) 694385..695935 + 1551 WP_003403119.1 MlaD family protein -
ORO19_RS03140 (ORO19_03140) 695987..696379 - 393 WP_003403122.1 type II toxin-antitoxin system toxin ribonuclease C4 Toxin
ORO19_RS03145 (ORO19_03145) 696376..696633 - 258 WP_003403125.1 type II toxin-antitoxin system antitoxin VapB4 Antitoxin
ORO19_RS03150 (ORO19_03150) 696816..698051 - 1236 WP_003403128.1 ATP-binding protein -
ORO19_RS03155 (ORO19_03155) 698302..698715 - 414 WP_003403137.1 type II toxin-antitoxin system VapC family toxin -
ORO19_RS03160 (ORO19_03160) 698712..698948 - 237 WP_003403139.1 type II toxin-antitoxin system antitoxin VapB27 -
ORO19_RS03165 (ORO19_03165) 699052..699558 - 507 WP_003900973.1 two component system sensor kinase HK1 -
ORO19_RS03170 (ORO19_03170) 699672..700202 - 531 WP_003917320.1 two component system sensor kinase HK2 -
ORO19_RS03175 (ORO19_03175) 700186..700881 - 696 WP_197044064.1 two-component system response regulator TcrA -
ORO19_RS03180 (ORO19_03180) 701004..701315 + 312 WP_003403164.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(8-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(3-53)


Sequences

Toxin        


Download         Length: 131 a.a.        Molecular weight: 14080.08 Da        Isoelectric Point: 4.6558

>T264987 WP_003403122.1 NZ_CP112996:c696379-695987 [Mycobacterium tuberculosis variant bovis]
VNVRRALADTSVFIGIEATRFDPDRFAGYEWGVSVVTLGELRLGVLQASGPEAAARRLSTYQLAQRFEPLGIDEAVSEAW
ALLVSKLRAAKLRVPINDSWIAATAVAHGIAILTQDNDYAAMPDVEVITI

Download         Length: 393 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9681.06 Da        Isoelectric Point: 7.0175

>AT264987 WP_003403125.1 NZ_CP112996:c696633-696376 [Mycobacterium tuberculosis variant bovis]
MSATIPARDLRNHTAEVLRRVAAGEEIEVLKDNRPVARIVPLKRRRQWLPAAEVIGELVRLGPDTTNLGEELRETLTQTT
DDVRW

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4F8V4

Antitoxin

Source ID Structure
AlphaFold DB G0TQ86

References