Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3736738..3737395 | Replicon | chromosome |
| Accession | NZ_CP112980 | ||
| Organism | Enterobacter hormaechei subsp. xiangfangensis strain CNCI 7 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A837FG63 |
| Locus tag | MTX27_RS17855 | Protein ID | WP_003863439.1 |
| Coordinates | 3736738..3737148 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | G8LDB7 |
| Locus tag | MTX27_RS17860 | Protein ID | WP_003863437.1 |
| Coordinates | 3737129..3737395 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MTX27_RS17835 (MTX27_17830) | 3732736..3734469 | - | 1734 | WP_022651808.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| MTX27_RS17840 (MTX27_17835) | 3734475..3735188 | - | 714 | WP_003863443.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| MTX27_RS17845 (MTX27_17840) | 3735217..3736113 | - | 897 | WP_003863442.1 | site-specific tyrosine recombinase XerD | - |
| MTX27_RS17850 (MTX27_17845) | 3736215..3736736 | + | 522 | WP_003863440.1 | flavodoxin FldB | - |
| MTX27_RS17855 (MTX27_17850) | 3736738..3737148 | - | 411 | WP_003863439.1 | protein YgfX | Toxin |
| MTX27_RS17860 (MTX27_17855) | 3737129..3737395 | - | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
| MTX27_RS17865 (MTX27_17860) | 3737690..3738670 | + | 981 | WP_100154205.1 | tRNA-modifying protein YgfZ | - |
| MTX27_RS17870 (MTX27_17865) | 3738756..3739415 | - | 660 | WP_003863433.1 | hemolysin III family protein | - |
| MTX27_RS17875 (MTX27_17870) | 3739682..3740413 | + | 732 | WP_003863431.1 | MurR/RpiR family transcriptional regulator | - |
| MTX27_RS17880 (MTX27_17875) | 3740530..3741963 | + | 1434 | WP_003863430.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16339.24 Da Isoelectric Point: 11.4775
>T264979 WP_003863439.1 NZ_CP112980:c3737148-3736738 [Enterobacter hormaechei subsp. xiangfangensis]
VVLWQSDLRVSWRSQWMSLLLHGLVAAMVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAAMVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FG63 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837F8P5 |