Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1091515..1092135 Replicon chromosome
Accession NZ_CP112980
Organism Enterobacter hormaechei subsp. xiangfangensis strain CNCI 7

Toxin (Protein)


Gene name Hha Uniprot ID A0A837FFM2
Locus tag MTX27_RS05175 Protein ID WP_015571250.1
Coordinates 1091515..1091733 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID F5RUW7
Locus tag MTX27_RS05180 Protein ID WP_006809850.1
Coordinates 1091761..1092135 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MTX27_RS05145 (MTX27_05145) 1087527..1087787 + 261 WP_015571255.1 type B 50S ribosomal protein L31 -
MTX27_RS05150 (MTX27_05150) 1087790..1087930 + 141 WP_003859006.1 type B 50S ribosomal protein L36 -
MTX27_RS05155 (MTX27_05155) 1087927..1088637 - 711 WP_022650493.1 GNAT family protein -
MTX27_RS05160 (MTX27_05160) 1088739..1090199 + 1461 WP_100154294.1 PLP-dependent aminotransferase family protein -
MTX27_RS05165 (MTX27_05165) 1090171..1090638 - 468 WP_022650495.1 YlaC family protein -
MTX27_RS05170 (MTX27_05170) 1090755..1091306 - 552 WP_022650496.1 maltose O-acetyltransferase -
MTX27_RS05175 (MTX27_05175) 1091515..1091733 - 219 WP_015571250.1 HHA domain-containing protein Toxin
MTX27_RS05180 (MTX27_05180) 1091761..1092135 - 375 WP_006809850.1 Hha toxicity modulator TomB Antitoxin
MTX27_RS05185 (MTX27_05185) 1092646..1095792 - 3147 WP_022650497.1 multidrug efflux RND transporter permease subunit AcrB -
MTX27_RS05190 (MTX27_05190) 1095815..1097008 - 1194 WP_022650498.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-114)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8583.95 Da        Isoelectric Point: 8.9008

>T264971 WP_015571250.1 NZ_CP112980:c1091733-1091515 [Enterobacter hormaechei subsp. xiangfangensis]
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14497.28 Da        Isoelectric Point: 4.8989

>AT264971 WP_006809850.1 NZ_CP112980:c1092135-1091761 [Enterobacter hormaechei subsp. xiangfangensis]
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A837FFM2

Antitoxin

Source ID Structure
AlphaFold DB A0A837FGN8

References