Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 300683..301279 | Replicon | chromosome |
| Accession | NZ_CP112980 | ||
| Organism | Enterobacter hormaechei subsp. xiangfangensis strain CNCI 7 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | A0A837F9W8 |
| Locus tag | MTX27_RS01450 | Protein ID | WP_023315213.1 |
| Coordinates | 300977..301279 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | MTX27_RS01445 | Protein ID | WP_032610152.1 |
| Coordinates | 300683..300970 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MTX27_RS01440 (MTX27_01440) | 299055..300686 | + | 1632 | WP_003860350.1 | Na/Pi cotransporter family protein | - |
| MTX27_RS01445 (MTX27_01445) | 300683..300970 | - | 288 | WP_032610152.1 | putative addiction module antidote protein | Antitoxin |
| MTX27_RS01450 (MTX27_01450) | 300977..301279 | - | 303 | WP_023315213.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| MTX27_RS01455 (MTX27_01455) | 301477..302349 | + | 873 | WP_003860347.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
| MTX27_RS01460 (MTX27_01460) | 302350..302622 | - | 273 | WP_003860346.1 | DUF3811 domain-containing protein | - |
| MTX27_RS01465 (MTX27_01465) | 302673..303617 | - | 945 | WP_032608239.1 | ketopantoate/pantoate/pantothenate transporter PanS | - |
| MTX27_RS01470 (MTX27_01470) | 303711..305060 | - | 1350 | WP_100154725.1 | lysine-sensitive aspartokinase 3 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11427.21 Da Isoelectric Point: 10.1042
>T264970 WP_023315213.1 NZ_CP112980:c301279-300977 [Enterobacter hormaechei subsp. xiangfangensis]
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDIRPVGEGISELRIHFGPGYRVYFKDQGNCIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDIRPVGEGISELRIHFGPGYRVYFKDQGNCIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
Download Length: 303 bp
Antitoxin
Download Length: 96 a.a. Molecular weight: 10072.60 Da Isoelectric Point: 5.7807
>AT264970 WP_032610152.1 NZ_CP112980:c300970-300683 [Enterobacter hormaechei subsp. xiangfangensis]
MHKLTPYDPANALVDDEEIAVFMADALETGDSAYIAKALGVIARAKGMSTISLQTGLSREQLYRSFSDKGNPTLKTTLAV
MKALGLGLTIKPSGD
MHKLTPYDPANALVDDEEIAVFMADALETGDSAYIAKALGVIARAKGMSTISLQTGLSREQLYRSFSDKGNPTLKTTLAV
MKALGLGLTIKPSGD
Download Length: 288 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|