Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 2481836..2482464 | Replicon | chromosome |
Accession | NZ_CP112978 | ||
Organism | Leptospira borgpetersenii strain I-3 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | M6E4U3 |
Locus tag | OR565_RS10655 | Protein ID | WP_002724218.1 |
Coordinates | 2482063..2482464 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | OR565_RS10650 | Protein ID | WP_010705987.1 |
Coordinates | 2481836..2482066 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OR565_RS10635 (OR565_10635) | 2479809..2480507 | - | 699 | WP_002724172.1 | hypothetical protein | - |
OR565_RS10640 (OR565_10640) | 2480690..2480918 | - | 229 | Protein_2098 | hypothetical protein | - |
OR565_RS10645 (OR565_10645) | 2481433..2481570 | - | 138 | WP_002736206.1 | hypothetical protein | - |
OR565_RS10650 (OR565_10650) | 2481836..2482066 | + | 231 | WP_010705987.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
OR565_RS10655 (OR565_10655) | 2482063..2482464 | + | 402 | WP_002724218.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OR565_RS10660 (OR565_10660) | 2482610..2482789 | - | 180 | WP_002724268.1 | hypothetical protein | - |
OR565_RS10665 (OR565_10665) | 2482899..2484581 | - | 1683 | WP_002724258.1 | dihydroxy-acid dehydratase | - |
OR565_RS10670 (OR565_10670) | 2484990..2485535 | + | 546 | WP_170874669.1 | metal-dependent hydrolase | - |
OR565_RS10675 (OR565_10675) | 2486328..2486618 | + | 291 | WP_002736220.1 | YciI family protein | - |
OR565_RS10680 (OR565_10680) | 2486627..2487323 | - | 697 | Protein_2106 | adenylate/guanylate cyclase domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 15501.23 Da Isoelectric Point: 9.9288
>T264969 WP_002724218.1 NZ_CP112978:2482063-2482464 [Leptospira borgpetersenii]
MTQYLLDTNICIYIINQKPRSVYKKFKKIKLENIFISSITEFELKYGVQKSLHFERNLKILEEFLSYLNILSFVSEDANK
AAKIRVELDKVGKPIGPFDLLIASQALSNKLTLVTNNEKEFTRIKDIKIANWL
MTQYLLDTNICIYIINQKPRSVYKKFKKIKLENIFISSITEFELKYGVQKSLHFERNLKILEEFLSYLNILSFVSEDANK
AAKIRVELDKVGKPIGPFDLLIASQALSNKLTLVTNNEKEFTRIKDIKIANWL
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|