Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpIK/PemK(toxin) |
Location | 539955..540531 | Replicon | chromosome |
Accession | NZ_CP112976 | ||
Organism | Leptospira kirschneri strain I-7 |
Toxin (Protein)
Gene name | chpK | Uniprot ID | A0A828YA21 |
Locus tag | ORQ95_RS02265 | Protein ID | WP_004755078.1 |
Coordinates | 540190..540531 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | chpI | Uniprot ID | A0A828Y9A4 |
Locus tag | ORQ95_RS02260 | Protein ID | WP_004759478.1 |
Coordinates | 539955..540203 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORQ95_RS02250 (ORQ95_02250) | 536434..537216 | + | 783 | WP_004754327.1 | ABC transporter ATP-binding protein | - |
ORQ95_RS02255 (ORQ95_02255) | 537213..539750 | + | 2538 | WP_004759514.1 | FtsX-like permease family protein | - |
ORQ95_RS02260 (ORQ95_02260) | 539955..540203 | + | 249 | WP_004759478.1 | hypothetical protein | Antitoxin |
ORQ95_RS02265 (ORQ95_02265) | 540190..540531 | + | 342 | WP_004755078.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
ORQ95_RS02270 (ORQ95_02270) | 540638..540787 | + | 150 | WP_004759513.1 | hypothetical protein | - |
ORQ95_RS02275 (ORQ95_02275) | 541604..541891 | - | 288 | WP_004754874.1 | hypothetical protein | - |
ORQ95_RS02280 (ORQ95_02280) | 542321..542869 | - | 549 | WP_004754121.1 | YqgE/AlgH family protein | - |
ORQ95_RS02285 (ORQ95_02285) | 542893..543861 | - | 969 | WP_004755369.1 | Gfo/Idh/MocA family oxidoreductase | - |
ORQ95_RS02290 (ORQ95_02290) | 544137..545255 | - | 1119 | WP_004760477.1 | molecular chaperone DnaJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12354.23 Da Isoelectric Point: 5.1486
>T264966 WP_004755078.1 NZ_CP112976:540190-540531 [Leptospira kirschneri]
MIRGEIWWVDLGIPFGSEPGFKRPVLIIQDDSFNQSNISTVVSIAITSNLNLSEAPGNVLIGKKESSLSKDSVVNVSQIV
TLDKERFIERVGKLKSSKINEVEVGLKLVTGLD
MIRGEIWWVDLGIPFGSEPGFKRPVLIIQDDSFNQSNISTVVSIAITSNLNLSEAPGNVLIGKKESSLSKDSVVNVSQIV
TLDKERFIERVGKLKSSKINEVEVGLKLVTGLD
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A828YA21 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A828Y9A4 |