Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-yefM/Txe-RelB |
Location | 124492..124999 | Replicon | chromosome |
Accession | NZ_CP112971 | ||
Organism | Rickettsia conorii subsp. heilongjiangensis strain B8 |
Toxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | OSR38_RS00665 | Protein ID | WP_267185184.1 |
Coordinates | 124492..124755 (-) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | G4KM09 |
Locus tag | OSR38_RS00670 | Protein ID | WP_014013838.1 |
Coordinates | 124748..124999 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OSR38_RS00640 (OSR38_00640) | 119997..120179 | + | 183 | WP_267185181.1 | hypothetical protein | - |
OSR38_RS00645 (OSR38_00645) | 120302..120925 | + | 624 | WP_267185182.1 | hypothetical protein | - |
OSR38_RS00650 (OSR38_00650) | 121029..122423 | - | 1395 | WP_014120498.1 | lipid IV(A) 3-deoxy-D-manno-octulosonic acid transferase | - |
OSR38_RS00655 (OSR38_00655) | 122420..123076 | - | 657 | WP_267185183.1 | lysophospholipid acyltransferase family protein | - |
OSR38_RS00660 (OSR38_00660) | 123227..124432 | - | 1206 | WP_014013836.1 | pyridoxal phosphate-dependent aminotransferase | - |
OSR38_RS00665 (OSR38_00665) | 124492..124755 | - | 264 | WP_267185184.1 | Txe/YoeB family addiction module toxin | Toxin |
OSR38_RS00670 (OSR38_00670) | 124748..124999 | - | 252 | WP_014013838.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OSR38_RS00675 (OSR38_00675) | 125139..126143 | + | 1005 | WP_267185185.1 | methyltransferase domain-containing protein | - |
OSR38_RS00680 (OSR38_00680) | 126148..126903 | + | 756 | WP_014013840.1 | VacJ family lipoprotein | - |
OSR38_RS00685 (OSR38_00685) | 126923..127522 | + | 600 | WP_267185186.1 | phospholipid-binding protein MlaC | - |
OSR38_RS00690 (OSR38_00690) | 127746..128033 | + | 288 | WP_045805280.1 | ribose-phosphate pyrophosphokinase-like domain-containing protein | - |
OSR38_RS00695 (OSR38_00695) | 128263..128610 | + | 348 | WP_267185525.1 | phosphoribosyltransferase family protein | - |
OSR38_RS00700 (OSR38_00700) | 128744..129811 | + | 1068 | WP_014013842.1 | alanine racemase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10580.35 Da Isoelectric Point: 9.8255
>T264964 WP_267185184.1 NZ_CP112971:c124755-124492 [Rickettsia conorii subsp. heilongjiangensis]
MIEIEWTLEAAEDLVYWKKYDIKKYERIKLLIKNIQEASFTGIGKPESLKHILSGLWSRRINHEHRLIYSVNTKQIIIYN
CRFHYKN
MIEIEWTLEAAEDLVYWKKYDIKKYERIKLLIKNIQEASFTGIGKPESLKHILSGLWSRRINHEHRLIYSVNTKQIIIYN
CRFHYKN
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|