Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 1269251..1269852 | Replicon | chromosome |
| Accession | NZ_CP112898 | ||
| Organism | Pasteurella multocida strain PF1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | ORH97_RS06030 | Protein ID | WP_078819687.1 |
| Coordinates | 1269538..1269852 (-) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | ORH97_RS06025 | Protein ID | WP_078819686.1 |
| Coordinates | 1269251..1269541 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORH97_RS05990 (ORH97_05990) | 1264271..1264486 | - | 216 | WP_075271368.1 | hypothetical protein | - |
| ORH97_RS05995 (ORH97_05995) | 1264483..1265166 | - | 684 | WP_078802160.1 | phage antirepressor KilAC domain-containing protein | - |
| ORH97_RS06000 (ORH97_06000) | 1265227..1265688 | - | 462 | WP_078802159.1 | hypothetical protein | - |
| ORH97_RS06005 (ORH97_06005) | 1265738..1265935 | - | 198 | WP_014390719.1 | helix-turn-helix domain-containing protein | - |
| ORH97_RS06010 (ORH97_06010) | 1266059..1266736 | + | 678 | WP_014390718.1 | XRE family transcriptional regulator | - |
| ORH97_RS06015 (ORH97_06015) | 1266947..1268791 | + | 1845 | WP_071523830.1 | DEAD/DEAH box helicase family protein | - |
| ORH97_RS06020 (ORH97_06020) | 1268821..1269225 | + | 405 | WP_146024473.1 | hypothetical protein | - |
| ORH97_RS06025 (ORH97_06025) | 1269251..1269541 | - | 291 | WP_078819686.1 | putative addiction module antidote protein | Antitoxin |
| ORH97_RS06030 (ORH97_06030) | 1269538..1269852 | - | 315 | WP_078819687.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| ORH97_RS06035 (ORH97_06035) | 1270157..1270324 | - | 168 | WP_005756653.1 | DUF1508 domain-containing protein | - |
| ORH97_RS06040 (ORH97_06040) | 1270337..1270546 | + | 210 | WP_005756656.1 | hypothetical protein | - |
| ORH97_RS06045 (ORH97_06045) | 1270788..1271018 | + | 231 | WP_078737821.1 | hypothetical protein | - |
| ORH97_RS06050 (ORH97_06050) | 1271031..1271201 | + | 171 | WP_155295599.1 | hypothetical protein | - |
| ORH97_RS06055 (ORH97_06055) | 1271182..1271376 | - | 195 | WP_078737822.1 | hypothetical protein | - |
| ORH97_RS06060 (ORH97_06060) | 1271588..1271851 | + | 264 | WP_071522857.1 | hypothetical protein | - |
| ORH97_RS06065 (ORH97_06065) | 1272098..1272760 | + | 663 | WP_078737830.1 | KilA-N domain-containing protein | - |
| ORH97_RS06070 (ORH97_06070) | 1272822..1273052 | - | 231 | WP_223251317.1 | hypothetical protein | - |
| ORH97_RS06075 (ORH97_06075) | 1273200..1273499 | + | 300 | WP_014391453.1 | hypothetical protein | - |
| ORH97_RS06080 (ORH97_06080) | 1273471..1273707 | + | 237 | WP_078801815.1 | hypothetical protein | - |
| ORH97_RS06085 (ORH97_06085) | 1273720..1274007 | + | 288 | WP_014391452.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1232380..1280198 | 47818 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11763.65 Da Isoelectric Point: 9.5553
>T264963 WP_078819687.1 NZ_CP112898:c1269852-1269538 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|