264962

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/upstrm_HI1419-dnstrm_HI1420
Location 2259309..2259910 Replicon chromosome
Accession NZ_CP112897
Organism Pasteurella multocida strain PF19

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag OR617_RS11010 Protein ID WP_078819687.1
Coordinates 2259309..2259623 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag OR617_RS11015 Protein ID WP_078819686.1
Coordinates 2259620..2259910 (+) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OR617_RS10955 (OR617_10955) 2254899..2255186 - 288 WP_014391452.1 hypothetical protein -
OR617_RS10960 (OR617_10960) 2255199..2255435 - 237 WP_075271355.1 hypothetical protein -
OR617_RS10965 (OR617_10965) 2255407..2255706 - 300 WP_078802174.1 hypothetical protein -
OR617_RS10970 (OR617_10970) 2255854..2256084 + 231 WP_223251317.1 hypothetical protein -
OR617_RS10975 (OR617_10975) 2256146..2256802 - 657 WP_225529682.1 KilA-N domain-containing protein -
OR617_RS10980 (OR617_10980) 2257052..2257420 - 369 Protein_2116 Bro-N domain-containing protein -
OR617_RS10985 (OR617_10985) 2257784..2257978 + 195 WP_014391459.1 hypothetical protein -
OR617_RS10990 (OR617_10990) 2257959..2258129 - 171 WP_225529669.1 hypothetical protein -
OR617_RS10995 (OR617_10995) 2258142..2258372 - 231 WP_078737821.1 hypothetical protein -
OR617_RS11000 (OR617_11000) 2258614..2258823 - 210 WP_005756656.1 hypothetical protein -
OR617_RS11005 (OR617_11005) 2258836..2259003 + 168 WP_005756653.1 DUF1508 domain-containing protein -
OR617_RS11010 (OR617_11010) 2259309..2259623 + 315 WP_078819687.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OR617_RS11015 (OR617_11015) 2259620..2259910 + 291 WP_078819686.1 putative addiction module antidote protein Antitoxin
OR617_RS11020 (OR617_11020) 2259936..2260340 - 405 WP_146024473.1 hypothetical protein -
OR617_RS11025 (OR617_11025) 2260370..2262214 - 1845 WP_071523830.1 DEAD/DEAH box helicase family protein -
OR617_RS11030 (OR617_11030) 2262425..2263108 - 684 WP_099821842.1 S24 family peptidase -
OR617_RS11035 (OR617_11035) 2263233..2263433 + 201 WP_099821841.1 YdaS family helix-turn-helix protein -
OR617_RS11040 (OR617_11040) 2263482..2263931 + 450 WP_099821840.1 YmfL family putative regulatory protein -
OR617_RS11045 (OR617_11045) 2263989..2264672 + 684 WP_014390721.1 phage antirepressor KilAC domain-containing protein -
OR617_RS11050 (OR617_11050) 2264669..2264884 + 216 WP_075271368.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2246833..2294989 48156


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(1-97)

Antitoxin

Cro/C1-type helix-turn-helix domain

(47-91)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11763.65 Da        Isoelectric Point: 9.5553

>T264962 WP_078819687.1 NZ_CP112897:2259309-2259623 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV

Download         Length: 315 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10574.22 Da        Isoelectric Point: 5.7134

>AT264962 WP_078819686.1 NZ_CP112897:2259620-2259910 [Pasteurella multocida]
MSKKVELKPFDIAEYLDSEEMIAAYLSEILETGDTNEFISALGDVARARGMTELAAKTGLGRESLYKTLSHGSKPRFDTI
MKITQALGIKLVPTHI

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References