Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 1269284..1269885 | Replicon | chromosome |
| Accession | NZ_CP112896 | ||
| Organism | Pasteurella multocida strain PF18 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | OR614_RS06055 | Protein ID | WP_078819687.1 |
| Coordinates | 1269571..1269885 (-) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | OR614_RS06050 | Protein ID | WP_078819686.1 |
| Coordinates | 1269284..1269574 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OR614_RS06015 (OR614_06015) | 1264306..1264521 | - | 216 | WP_075271368.1 | hypothetical protein | - |
| OR614_RS06020 (OR614_06020) | 1264518..1265201 | - | 684 | WP_078802160.1 | phage antirepressor KilAC domain-containing protein | - |
| OR614_RS06025 (OR614_06025) | 1265203..1265721 | - | 519 | WP_267173073.1 | hypothetical protein | - |
| OR614_RS06030 (OR614_06030) | 1265771..1265968 | - | 198 | WP_014390719.1 | helix-turn-helix domain-containing protein | - |
| OR614_RS06035 (OR614_06035) | 1266092..1266769 | + | 678 | WP_014390718.1 | XRE family transcriptional regulator | - |
| OR614_RS06040 (OR614_06040) | 1266980..1268824 | + | 1845 | WP_071523830.1 | DEAD/DEAH box helicase family protein | - |
| OR614_RS06045 (OR614_06045) | 1268854..1269258 | + | 405 | WP_146024473.1 | hypothetical protein | - |
| OR614_RS06050 (OR614_06050) | 1269284..1269574 | - | 291 | WP_078819686.1 | putative addiction module antidote protein | Antitoxin |
| OR614_RS06055 (OR614_06055) | 1269571..1269885 | - | 315 | WP_078819687.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OR614_RS06060 (OR614_06060) | 1270190..1270357 | - | 168 | WP_005756653.1 | DUF1508 domain-containing protein | - |
| OR614_RS06065 (OR614_06065) | 1270370..1270579 | + | 210 | WP_005756656.1 | hypothetical protein | - |
| OR614_RS06070 (OR614_06070) | 1270821..1271051 | + | 231 | WP_078737821.1 | hypothetical protein | - |
| OR614_RS06075 (OR614_06075) | 1271064..1271234 | + | 171 | WP_155295599.1 | hypothetical protein | - |
| OR614_RS06080 (OR614_06080) | 1271215..1271409 | - | 195 | WP_078737822.1 | hypothetical protein | - |
| OR614_RS06085 (OR614_06085) | 1271621..1271884 | + | 264 | WP_071522857.1 | hypothetical protein | - |
| OR614_RS06090 (OR614_06090) | 1272131..1272277 | + | 147 | WP_267173074.1 | hypothetical protein | - |
| OR614_RS06095 (OR614_06095) | 1272286..1272375 | + | 90 | Protein_1169 | hypothetical protein | - |
| OR614_RS06100 (OR614_06100) | 1272424..1272798 | + | 375 | WP_267173075.1 | hypothetical protein | - |
| OR614_RS06105 (OR614_06105) | 1272860..1273090 | - | 231 | WP_223251317.1 | hypothetical protein | - |
| OR614_RS06110 (OR614_06110) | 1273238..1273450 | + | 213 | WP_267173076.1 | hypothetical protein | - |
| OR614_RS06115 (OR614_06115) | 1273508..1273744 | + | 237 | WP_078801815.1 | hypothetical protein | - |
| OR614_RS06120 (OR614_06120) | 1273757..1274044 | + | 288 | WP_014391452.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1232415..1280236 | 47821 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11763.65 Da Isoelectric Point: 9.5553
>T264961 WP_078819687.1 NZ_CP112896:c1269885-1269571 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|