264961

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/upstrm_HI1419-dnstrm_HI1420
Location 1269284..1269885 Replicon chromosome
Accession NZ_CP112896
Organism Pasteurella multocida strain PF18

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag OR614_RS06055 Protein ID WP_078819687.1
Coordinates 1269571..1269885 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag OR614_RS06050 Protein ID WP_078819686.1
Coordinates 1269284..1269574 (-) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OR614_RS06015 (OR614_06015) 1264306..1264521 - 216 WP_075271368.1 hypothetical protein -
OR614_RS06020 (OR614_06020) 1264518..1265201 - 684 WP_078802160.1 phage antirepressor KilAC domain-containing protein -
OR614_RS06025 (OR614_06025) 1265203..1265721 - 519 WP_267173073.1 hypothetical protein -
OR614_RS06030 (OR614_06030) 1265771..1265968 - 198 WP_014390719.1 helix-turn-helix domain-containing protein -
OR614_RS06035 (OR614_06035) 1266092..1266769 + 678 WP_014390718.1 XRE family transcriptional regulator -
OR614_RS06040 (OR614_06040) 1266980..1268824 + 1845 WP_071523830.1 DEAD/DEAH box helicase family protein -
OR614_RS06045 (OR614_06045) 1268854..1269258 + 405 WP_146024473.1 hypothetical protein -
OR614_RS06050 (OR614_06050) 1269284..1269574 - 291 WP_078819686.1 putative addiction module antidote protein Antitoxin
OR614_RS06055 (OR614_06055) 1269571..1269885 - 315 WP_078819687.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OR614_RS06060 (OR614_06060) 1270190..1270357 - 168 WP_005756653.1 DUF1508 domain-containing protein -
OR614_RS06065 (OR614_06065) 1270370..1270579 + 210 WP_005756656.1 hypothetical protein -
OR614_RS06070 (OR614_06070) 1270821..1271051 + 231 WP_078737821.1 hypothetical protein -
OR614_RS06075 (OR614_06075) 1271064..1271234 + 171 WP_155295599.1 hypothetical protein -
OR614_RS06080 (OR614_06080) 1271215..1271409 - 195 WP_078737822.1 hypothetical protein -
OR614_RS06085 (OR614_06085) 1271621..1271884 + 264 WP_071522857.1 hypothetical protein -
OR614_RS06090 (OR614_06090) 1272131..1272277 + 147 WP_267173074.1 hypothetical protein -
OR614_RS06095 (OR614_06095) 1272286..1272375 + 90 Protein_1169 hypothetical protein -
OR614_RS06100 (OR614_06100) 1272424..1272798 + 375 WP_267173075.1 hypothetical protein -
OR614_RS06105 (OR614_06105) 1272860..1273090 - 231 WP_223251317.1 hypothetical protein -
OR614_RS06110 (OR614_06110) 1273238..1273450 + 213 WP_267173076.1 hypothetical protein -
OR614_RS06115 (OR614_06115) 1273508..1273744 + 237 WP_078801815.1 hypothetical protein -
OR614_RS06120 (OR614_06120) 1273757..1274044 + 288 WP_014391452.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1232415..1280236 47821


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(1-97)

Antitoxin

Cro/C1-type helix-turn-helix domain

(47-91)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11763.65 Da        Isoelectric Point: 9.5553

>T264961 WP_078819687.1 NZ_CP112896:c1269885-1269571 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV

Download         Length: 315 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10574.22 Da        Isoelectric Point: 5.7134

>AT264961 WP_078819686.1 NZ_CP112896:c1269574-1269284 [Pasteurella multocida]
MSKKVELKPFDIAEYLDSEEMIAAYLSEILETGDTNEFISALGDVARARGMTELAAKTGLGRESLYKTLSHGSKPRFDTI
MKITQALGIKLVPTHI

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References