Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/upstrm_HI1419-dnstrm_HI1420
Location 2258969..2259570 Replicon chromosome
Accession NZ_CP112895
Organism Pasteurella multocida strain PF17

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag OR612_RS11015 Protein ID WP_078819687.1
Coordinates 2258969..2259283 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag OR612_RS11020 Protein ID WP_078819686.1
Coordinates 2259280..2259570 (+) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OR612_RS10960 (OR612_10960) 2254559..2254846 - 288 WP_014391452.1 hypothetical protein -
OR612_RS10965 (OR612_10965) 2254859..2255095 - 237 WP_075271355.1 hypothetical protein -
OR612_RS10970 (OR612_10970) 2255067..2255366 - 300 WP_078802174.1 hypothetical protein -
OR612_RS10975 (OR612_10975) 2255514..2255744 + 231 WP_223251317.1 hypothetical protein -
OR612_RS10980 (OR612_10980) 2255806..2256462 - 657 WP_225529682.1 KilA-N domain-containing protein -
OR612_RS10985 (OR612_10985) 2256712..2257080 - 369 Protein_2117 Bro-N domain-containing protein -
OR612_RS10990 (OR612_10990) 2257444..2257638 + 195 WP_014391459.1 hypothetical protein -
OR612_RS10995 (OR612_10995) 2257619..2257789 - 171 WP_225529669.1 hypothetical protein -
OR612_RS11000 (OR612_11000) 2257802..2258032 - 231 WP_078737821.1 hypothetical protein -
OR612_RS11005 (OR612_11005) 2258274..2258483 - 210 WP_005756656.1 hypothetical protein -
OR612_RS11010 (OR612_11010) 2258496..2258663 + 168 WP_005756653.1 DUF1508 domain-containing protein -
OR612_RS11015 (OR612_11015) 2258969..2259283 + 315 WP_078819687.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OR612_RS11020 (OR612_11020) 2259280..2259570 + 291 WP_078819686.1 putative addiction module antidote protein Antitoxin
OR612_RS11025 (OR612_11025) 2259596..2260000 - 405 WP_146024473.1 hypothetical protein -
OR612_RS11030 (OR612_11030) 2260030..2261874 - 1845 WP_071523830.1 DEAD/DEAH box helicase family protein -
OR612_RS11035 (OR612_11035) 2262085..2262768 - 684 WP_099821842.1 S24 family peptidase -
OR612_RS11040 (OR612_11040) 2262893..2263093 + 201 WP_099821841.1 YdaS family helix-turn-helix protein -
OR612_RS11045 (OR612_11045) 2263142..2263591 + 450 WP_099821840.1 YmfL family putative regulatory protein -
OR612_RS11050 (OR612_11050) 2263649..2264332 + 684 WP_014390721.1 phage antirepressor KilAC domain-containing protein -
OR612_RS11055 (OR612_11055) 2264329..2264544 + 216 WP_075271368.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2246495..2294646 48151


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(1-97)

Antitoxin

Cro/C1-type helix-turn-helix domain

(47-91)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11763.65 Da        Isoelectric Point: 9.5553

>T264960 WP_078819687.1 NZ_CP112895:2258969-2259283 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV

Download         Length: 315 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10574.22 Da        Isoelectric Point: 5.7134

>AT264960 WP_078819686.1 NZ_CP112895:2259280-2259570 [Pasteurella multocida]
MSKKVELKPFDIAEYLDSEEMIAAYLSEILETGDTNEFISALGDVARARGMTELAAKTGLGRESLYKTLSHGSKPRFDTI
MKITQALGIKLVPTHI

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References