Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 1435824..1436425 | Replicon | chromosome |
| Accession | NZ_CP112894 | ||
| Organism | Pasteurella multocida strain PF16 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | OR611_RS07270 | Protein ID | WP_078819687.1 |
| Coordinates | 1435824..1436138 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | OR611_RS07275 | Protein ID | WP_078819686.1 |
| Coordinates | 1436135..1436425 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OR611_RS07215 (OR611_07215) | 1431669..1431956 | - | 288 | WP_014391452.1 | hypothetical protein | - |
| OR611_RS07220 (OR611_07220) | 1431969..1432205 | - | 237 | WP_078801815.1 | hypothetical protein | - |
| OR611_RS07225 (OR611_07225) | 1432177..1432476 | - | 300 | WP_014391453.1 | hypothetical protein | - |
| OR611_RS07230 (OR611_07230) | 1432624..1432854 | + | 231 | WP_223251317.1 | hypothetical protein | - |
| OR611_RS07235 (OR611_07235) | 1432916..1433578 | - | 663 | WP_078737830.1 | KilA-N domain-containing protein | - |
| OR611_RS07240 (OR611_07240) | 1433825..1434088 | - | 264 | WP_071522857.1 | hypothetical protein | - |
| OR611_RS07245 (OR611_07245) | 1434300..1434494 | + | 195 | WP_078737822.1 | hypothetical protein | - |
| OR611_RS07250 (OR611_07250) | 1434475..1434645 | - | 171 | WP_155295599.1 | hypothetical protein | - |
| OR611_RS07255 (OR611_07255) | 1434658..1434888 | - | 231 | WP_078737821.1 | hypothetical protein | - |
| OR611_RS07260 (OR611_07260) | 1435130..1435339 | - | 210 | WP_005756656.1 | hypothetical protein | - |
| OR611_RS07265 (OR611_07265) | 1435352..1435519 | + | 168 | WP_005756653.1 | DUF1508 domain-containing protein | - |
| OR611_RS07270 (OR611_07270) | 1435824..1436138 | + | 315 | WP_078819687.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OR611_RS07275 (OR611_07275) | 1436135..1436425 | + | 291 | WP_078819686.1 | putative addiction module antidote protein | Antitoxin |
| OR611_RS07280 (OR611_07280) | 1436451..1436888 | - | 438 | WP_078819883.1 | hypothetical protein | - |
| OR611_RS07285 (OR611_07285) | 1436885..1438729 | - | 1845 | WP_071523830.1 | DEAD/DEAH box helicase family protein | - |
| OR611_RS07290 (OR611_07290) | 1438940..1439389 | - | 450 | WP_267160554.1 | S24 family peptidase | - |
| OR611_RS07295 (OR611_07295) | 1439370..1439612 | - | 243 | WP_267160555.1 | helix-turn-helix transcriptional regulator | - |
| OR611_RS07300 (OR611_07300) | 1439736..1439933 | + | 198 | WP_014390719.1 | helix-turn-helix domain-containing protein | - |
| OR611_RS07305 (OR611_07305) | 1439983..1440444 | + | 462 | WP_078802159.1 | hypothetical protein | - |
| OR611_RS07310 (OR611_07310) | 1440505..1441188 | + | 684 | WP_078802160.1 | phage antirepressor KilAC domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1425478..1467949 | 42471 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11763.65 Da Isoelectric Point: 9.5553
>T264959 WP_078819687.1 NZ_CP112894:1435824-1436138 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|