Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/upstrm_HI1419-dnstrm_HI1420
Location 1435824..1436425 Replicon chromosome
Accession NZ_CP112894
Organism Pasteurella multocida strain PF16

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag OR611_RS07270 Protein ID WP_078819687.1
Coordinates 1435824..1436138 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag OR611_RS07275 Protein ID WP_078819686.1
Coordinates 1436135..1436425 (+) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OR611_RS07215 (OR611_07215) 1431669..1431956 - 288 WP_014391452.1 hypothetical protein -
OR611_RS07220 (OR611_07220) 1431969..1432205 - 237 WP_078801815.1 hypothetical protein -
OR611_RS07225 (OR611_07225) 1432177..1432476 - 300 WP_014391453.1 hypothetical protein -
OR611_RS07230 (OR611_07230) 1432624..1432854 + 231 WP_223251317.1 hypothetical protein -
OR611_RS07235 (OR611_07235) 1432916..1433578 - 663 WP_078737830.1 KilA-N domain-containing protein -
OR611_RS07240 (OR611_07240) 1433825..1434088 - 264 WP_071522857.1 hypothetical protein -
OR611_RS07245 (OR611_07245) 1434300..1434494 + 195 WP_078737822.1 hypothetical protein -
OR611_RS07250 (OR611_07250) 1434475..1434645 - 171 WP_155295599.1 hypothetical protein -
OR611_RS07255 (OR611_07255) 1434658..1434888 - 231 WP_078737821.1 hypothetical protein -
OR611_RS07260 (OR611_07260) 1435130..1435339 - 210 WP_005756656.1 hypothetical protein -
OR611_RS07265 (OR611_07265) 1435352..1435519 + 168 WP_005756653.1 DUF1508 domain-containing protein -
OR611_RS07270 (OR611_07270) 1435824..1436138 + 315 WP_078819687.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OR611_RS07275 (OR611_07275) 1436135..1436425 + 291 WP_078819686.1 putative addiction module antidote protein Antitoxin
OR611_RS07280 (OR611_07280) 1436451..1436888 - 438 WP_078819883.1 hypothetical protein -
OR611_RS07285 (OR611_07285) 1436885..1438729 - 1845 WP_071523830.1 DEAD/DEAH box helicase family protein -
OR611_RS07290 (OR611_07290) 1438940..1439389 - 450 WP_267160554.1 S24 family peptidase -
OR611_RS07295 (OR611_07295) 1439370..1439612 - 243 WP_267160555.1 helix-turn-helix transcriptional regulator -
OR611_RS07300 (OR611_07300) 1439736..1439933 + 198 WP_014390719.1 helix-turn-helix domain-containing protein -
OR611_RS07305 (OR611_07305) 1439983..1440444 + 462 WP_078802159.1 hypothetical protein -
OR611_RS07310 (OR611_07310) 1440505..1441188 + 684 WP_078802160.1 phage antirepressor KilAC domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1425478..1467949 42471


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(1-97)

Antitoxin

Cro/C1-type helix-turn-helix domain

(47-91)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11763.65 Da        Isoelectric Point: 9.5553

>T264959 WP_078819687.1 NZ_CP112894:1435824-1436138 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV

Download         Length: 315 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10574.22 Da        Isoelectric Point: 5.7134

>AT264959 WP_078819686.1 NZ_CP112894:1436135-1436425 [Pasteurella multocida]
MSKKVELKPFDIAEYLDSEEMIAAYLSEILETGDTNEFISALGDVARARGMTELAAKTGLGRESLYKTLSHGSKPRFDTI
MKITQALGIKLVPTHI

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References