Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/upstrm_HI1419-dnstrm_HI1420
Location 2262827..2263428 Replicon chromosome
Accession NZ_CP112893
Organism Pasteurella multocida strain PF15

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag OR610_RS11015 Protein ID WP_078819687.1
Coordinates 2262827..2263141 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag OR610_RS11020 Protein ID WP_265176302.1
Coordinates 2263138..2263428 (+) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OR610_RS10965 (OR610_10965) 2258041..2258271 + 231 WP_223251317.1 hypothetical protein -
OR610_RS10970 (OR610_10970) 2258333..2259040 - 708 WP_267174720.1 KilA-N domain-containing protein -
OR610_RS10975 (OR610_10975) 2259290..2259658 - 369 Protein_2115 Bro-N domain-containing protein -
OR610_RS10980 (OR610_10980) 2259999..2260124 + 126 WP_014391103.1 hypothetical protein -
OR610_RS10985 (OR610_10985) 2260125..2260658 - 534 WP_014391102.1 hypothetical protein -
OR610_RS10990 (OR610_10990) 2261303..2261497 + 195 WP_014391459.1 hypothetical protein -
OR610_RS10995 (OR610_10995) 2261478..2261648 - 171 WP_014391460.1 hypothetical protein -
OR610_RS11000 (OR610_11000) 2261661..2261891 - 231 WP_075271373.1 hypothetical protein -
OR610_RS11005 (OR610_11005) 2262133..2262342 - 210 WP_005756656.1 hypothetical protein -
OR610_RS11010 (OR610_11010) 2262355..2262522 + 168 WP_005756653.1 DUF1508 domain-containing protein -
OR610_RS11015 (OR610_11015) 2262827..2263141 + 315 WP_078819687.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OR610_RS11020 (OR610_11020) 2263138..2263428 + 291 WP_265176302.1 putative addiction module antidote protein Antitoxin
OR610_RS11025 (OR610_11025) 2263455..2264375 - 921 WP_265164248.1 hypothetical protein -
OR610_RS11030 (OR610_11030) 2264466..2265122 - 657 WP_016570077.1 XRE family transcriptional regulator -
OR610_RS11035 (OR610_11035) 2265253..2265459 + 207 WP_071523618.1 helix-turn-helix transcriptional regulator -
OR610_RS11040 (OR610_11040) 2265508..2265969 + 462 WP_267174535.1 hypothetical protein -
OR610_RS11045 (OR610_11045) 2266021..2266704 + 684 Protein_2129 phage antirepressor KilAC domain-containing protein -
OR610_RS11050 (OR610_11050) 2266701..2266970 + 270 WP_267174536.1 hypothetical protein -
OR610_RS11055 (OR610_11055) 2266912..2267178 + 267 Protein_2131 helix-turn-helix domain-containing protein -
OR610_RS11060 (OR610_11060) 2267294..2267725 + 432 WP_267174537.1 hypothetical protein -
OR610_RS11065 (OR610_11065) 2267869..2268411 + 543 WP_267174538.1 replication protein P -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2249854..2296973 47119


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(1-97)

Antitoxin

Uncharacterized protein HI1420

(6-91)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11763.65 Da        Isoelectric Point: 9.5553

>T264958 WP_078819687.1 NZ_CP112893:2262827-2263141 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV

Download         Length: 315 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10632.26 Da        Isoelectric Point: 5.1585

>AT264958 WP_265176302.1 NZ_CP112893:2263138-2263428 [Pasteurella multocida]
MSKKVELKPFDIAEYLDSEEMIAAYLSEILETGDTNEFISALGDVARARGMTELAEKTGLGRESLYKTLSHGSKPRFDTI
MKITQALGIKLVPTHI

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References