Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/upstrm_HI1419-dnstrm_HI1420
Location 59490..60091 Replicon chromosome
Accession NZ_CP112893
Organism Pasteurella multocida strain PF15

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag OR610_RS00400 Protein ID WP_078819687.1
Coordinates 59490..59804 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag OR610_RS00405 Protein ID WP_265176302.1
Coordinates 59801..60091 (+) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OR610_RS00345 (OR610_00345) 54786..55016 + 231 WP_223251317.1 hypothetical protein -
OR610_RS00350 (OR610_00350) 55078..55785 - 708 WP_267174720.1 KilA-N domain-containing protein -
OR610_RS00355 (OR610_00355) 56035..56403 - 369 Protein_66 Bro-N domain-containing protein -
OR610_RS00360 (OR610_00360) 56744..56869 + 126 WP_014391103.1 hypothetical protein -
OR610_RS00365 (OR610_00365) 56870..57403 - 534 WP_014391102.1 hypothetical protein -
OR610_RS00370 (OR610_00370) 57491..57754 - 264 WP_071522857.1 hypothetical protein -
OR610_RS00375 (OR610_00375) 57966..58160 + 195 WP_014391459.1 hypothetical protein -
OR610_RS00380 (OR610_00380) 58141..58311 - 171 WP_014391460.1 hypothetical protein -
OR610_RS00385 (OR610_00385) 58324..58554 - 231 WP_075271373.1 hypothetical protein -
OR610_RS00390 (OR610_00390) 58796..59005 - 210 WP_005756656.1 hypothetical protein -
OR610_RS00395 (OR610_00395) 59018..59185 + 168 WP_005756653.1 DUF1508 domain-containing protein -
OR610_RS00400 (OR610_00400) 59490..59804 + 315 WP_078819687.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OR610_RS00405 (OR610_00405) 59801..60091 + 291 WP_265176302.1 putative addiction module antidote protein Antitoxin
OR610_RS00410 (OR610_00410) 60118..61038 - 921 WP_265164248.1 hypothetical protein -
OR610_RS00415 (OR610_00415) 61129..61784 - 656 Protein_78 XRE family transcriptional regulator -
OR610_RS00420 (OR610_00420) 61915..62121 + 207 WP_071523618.1 helix-turn-helix transcriptional regulator -
OR610_RS00425 (OR610_00425) 62170..62631 + 462 WP_267174535.1 hypothetical protein -
OR610_RS00430 (OR610_00430) 62683..63366 + 684 WP_014390721.1 phage antirepressor KilAC domain-containing protein -
OR610_RS00435 (OR610_00435) 63363..63578 + 216 WP_075271368.1 hypothetical protein -
OR610_RS00440 (OR610_00440) 63575..63960 + 386 Protein_83 helix-turn-helix domain-containing protein -
OR610_RS00445 (OR610_00445) 63985..64389 + 405 WP_267174722.1 hypothetical protein -
OR610_RS00450 (OR610_00450) 64389..64922 + 534 WP_267174571.1 replication protein P -
OR610_RS00455 (OR610_00455) 64919..65077 + 159 WP_267174572.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 45651..95457 49806


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(1-97)

Antitoxin

Uncharacterized protein HI1420

(6-91)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11763.65 Da        Isoelectric Point: 9.5553

>T264957 WP_078819687.1 NZ_CP112893:59490-59804 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV

Download         Length: 315 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10632.26 Da        Isoelectric Point: 5.1585

>AT264957 WP_265176302.1 NZ_CP112893:59801-60091 [Pasteurella multocida]
MSKKVELKPFDIAEYLDSEEMIAAYLSEILETGDTNEFISALGDVARARGMTELAEKTGLGRESLYKTLSHGSKPRFDTI
MKITQALGIKLVPTHI

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References