Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/upstrm_HI1419-dnstrm_HI1420
Location 1269286..1269887 Replicon chromosome
Accession NZ_CP112892
Organism Pasteurella multocida strain PF14

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag OR608_RS06055 Protein ID WP_078819687.1
Coordinates 1269573..1269887 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag OR608_RS06050 Protein ID WP_078819686.1
Coordinates 1269286..1269576 (-) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OR608_RS06015 (OR608_06015) 1264306..1264521 - 216 WP_075271368.1 hypothetical protein -
OR608_RS06020 (OR608_06020) 1264518..1265201 - 684 WP_078802160.1 phage antirepressor KilAC domain-containing protein -
OR608_RS06025 (OR608_06025) 1265262..1265723 - 462 WP_078802159.1 hypothetical protein -
OR608_RS06030 (OR608_06030) 1265773..1265970 - 198 WP_014390719.1 helix-turn-helix domain-containing protein -
OR608_RS06035 (OR608_06035) 1266094..1266771 + 678 WP_014390718.1 XRE family transcriptional regulator -
OR608_RS06040 (OR608_06040) 1266982..1268826 + 1845 WP_071523830.1 DEAD/DEAH box helicase family protein -
OR608_RS06045 (OR608_06045) 1268856..1269260 + 405 WP_146024473.1 hypothetical protein -
OR608_RS06050 (OR608_06050) 1269286..1269576 - 291 WP_078819686.1 putative addiction module antidote protein Antitoxin
OR608_RS06055 (OR608_06055) 1269573..1269887 - 315 WP_078819687.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OR608_RS06060 (OR608_06060) 1270192..1270359 - 168 WP_005756653.1 DUF1508 domain-containing protein -
OR608_RS06065 (OR608_06065) 1270372..1270581 + 210 WP_005756656.1 hypothetical protein -
OR608_RS06070 (OR608_06070) 1270823..1271053 + 231 WP_078737821.1 hypothetical protein -
OR608_RS06075 (OR608_06075) 1271066..1271236 + 171 WP_155295599.1 hypothetical protein -
OR608_RS06080 (OR608_06080) 1271217..1271411 - 195 WP_078737822.1 hypothetical protein -
OR608_RS06085 (OR608_06085) 1271623..1271886 + 264 WP_071522857.1 hypothetical protein -
OR608_RS06090 (OR608_06090) 1272133..1272795 + 663 WP_078737830.1 KilA-N domain-containing protein -
OR608_RS06095 (OR608_06095) 1272857..1273087 - 231 WP_223251317.1 hypothetical protein -
OR608_RS06100 (OR608_06100) 1273235..1273534 + 300 WP_014391453.1 hypothetical protein -
OR608_RS06105 (OR608_06105) 1273506..1273742 + 237 WP_078801815.1 hypothetical protein -
OR608_RS06110 (OR608_06110) 1273755..1274042 + 288 WP_014391452.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1232417..1280232 47815


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(1-97)

Antitoxin

Cro/C1-type helix-turn-helix domain

(47-91)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11763.65 Da        Isoelectric Point: 9.5553

>T264956 WP_078819687.1 NZ_CP112892:c1269887-1269573 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV

Download         Length: 315 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10574.22 Da        Isoelectric Point: 5.7134

>AT264956 WP_078819686.1 NZ_CP112892:c1269576-1269286 [Pasteurella multocida]
MSKKVELKPFDIAEYLDSEEMIAAYLSEILETGDTNEFISALGDVARARGMTELAAKTGLGRESLYKTLSHGSKPRFDTI
MKITQALGIKLVPTHI

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References