Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 1269310..1269911 | Replicon | chromosome |
| Accession | NZ_CP112891 | ||
| Organism | Pasteurella multocida strain PF12 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | OR603_RS06035 | Protein ID | WP_078819687.1 |
| Coordinates | 1269597..1269911 (-) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | OR603_RS06030 | Protein ID | WP_078819686.1 |
| Coordinates | 1269310..1269600 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OR603_RS05995 (OR603_05995) | 1264332..1264493 | - | 162 | WP_267174405.1 | hypothetical protein | - |
| OR603_RS06000 (OR603_06000) | 1264498..1265226 | - | 729 | WP_267174406.1 | phage antirepressor KilAC domain-containing protein | - |
| OR603_RS06005 (OR603_06005) | 1265287..1265748 | - | 462 | WP_078802159.1 | hypothetical protein | - |
| OR603_RS06010 (OR603_06010) | 1265798..1265995 | - | 198 | WP_014390719.1 | helix-turn-helix domain-containing protein | - |
| OR603_RS06015 (OR603_06015) | 1266118..1266795 | + | 678 | WP_267174407.1 | XRE family transcriptional regulator | - |
| OR603_RS06020 (OR603_06020) | 1267006..1268850 | + | 1845 | WP_071523830.1 | DEAD/DEAH box helicase family protein | - |
| OR603_RS06025 (OR603_06025) | 1268880..1269284 | + | 405 | WP_146024473.1 | hypothetical protein | - |
| OR603_RS06030 (OR603_06030) | 1269310..1269600 | - | 291 | WP_078819686.1 | putative addiction module antidote protein | Antitoxin |
| OR603_RS06035 (OR603_06035) | 1269597..1269911 | - | 315 | WP_078819687.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OR603_RS06040 (OR603_06040) | 1270216..1270383 | - | 168 | WP_005756653.1 | DUF1508 domain-containing protein | - |
| OR603_RS06045 (OR603_06045) | 1270396..1270605 | + | 210 | WP_005756656.1 | hypothetical protein | - |
| OR603_RS06050 (OR603_06050) | 1270847..1271077 | + | 231 | WP_078737821.1 | hypothetical protein | - |
| OR603_RS06055 (OR603_06055) | 1271090..1271260 | + | 171 | WP_155295599.1 | hypothetical protein | - |
| OR603_RS06060 (OR603_06060) | 1271241..1271435 | - | 195 | WP_078737822.1 | hypothetical protein | - |
| OR603_RS06065 (OR603_06065) | 1271647..1271910 | + | 264 | WP_071522857.1 | hypothetical protein | - |
| OR603_RS06070 (OR603_06070) | 1272160..1272822 | + | 663 | WP_078737830.1 | KilA-N domain-containing protein | - |
| OR603_RS06075 (OR603_06075) | 1272884..1273114 | - | 231 | WP_223251317.1 | hypothetical protein | - |
| OR603_RS06080 (OR603_06080) | 1273262..1273474 | + | 213 | WP_267173076.1 | hypothetical protein | - |
| OR603_RS06085 (OR603_06085) | 1273532..1273768 | + | 237 | WP_078801815.1 | hypothetical protein | - |
| OR603_RS06090 (OR603_06090) | 1273781..1274068 | + | 288 | WP_014391452.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1232438..1280259 | 47821 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11763.65 Da Isoelectric Point: 9.5553
>T264955 WP_078819687.1 NZ_CP112891:c1269911-1269597 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|