Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/upstrm_HI1419-dnstrm_HI1420
Location 1269310..1269911 Replicon chromosome
Accession NZ_CP112891
Organism Pasteurella multocida strain PF12

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag OR603_RS06035 Protein ID WP_078819687.1
Coordinates 1269597..1269911 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag OR603_RS06030 Protein ID WP_078819686.1
Coordinates 1269310..1269600 (-) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OR603_RS05995 (OR603_05995) 1264332..1264493 - 162 WP_267174405.1 hypothetical protein -
OR603_RS06000 (OR603_06000) 1264498..1265226 - 729 WP_267174406.1 phage antirepressor KilAC domain-containing protein -
OR603_RS06005 (OR603_06005) 1265287..1265748 - 462 WP_078802159.1 hypothetical protein -
OR603_RS06010 (OR603_06010) 1265798..1265995 - 198 WP_014390719.1 helix-turn-helix domain-containing protein -
OR603_RS06015 (OR603_06015) 1266118..1266795 + 678 WP_267174407.1 XRE family transcriptional regulator -
OR603_RS06020 (OR603_06020) 1267006..1268850 + 1845 WP_071523830.1 DEAD/DEAH box helicase family protein -
OR603_RS06025 (OR603_06025) 1268880..1269284 + 405 WP_146024473.1 hypothetical protein -
OR603_RS06030 (OR603_06030) 1269310..1269600 - 291 WP_078819686.1 putative addiction module antidote protein Antitoxin
OR603_RS06035 (OR603_06035) 1269597..1269911 - 315 WP_078819687.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OR603_RS06040 (OR603_06040) 1270216..1270383 - 168 WP_005756653.1 DUF1508 domain-containing protein -
OR603_RS06045 (OR603_06045) 1270396..1270605 + 210 WP_005756656.1 hypothetical protein -
OR603_RS06050 (OR603_06050) 1270847..1271077 + 231 WP_078737821.1 hypothetical protein -
OR603_RS06055 (OR603_06055) 1271090..1271260 + 171 WP_155295599.1 hypothetical protein -
OR603_RS06060 (OR603_06060) 1271241..1271435 - 195 WP_078737822.1 hypothetical protein -
OR603_RS06065 (OR603_06065) 1271647..1271910 + 264 WP_071522857.1 hypothetical protein -
OR603_RS06070 (OR603_06070) 1272160..1272822 + 663 WP_078737830.1 KilA-N domain-containing protein -
OR603_RS06075 (OR603_06075) 1272884..1273114 - 231 WP_223251317.1 hypothetical protein -
OR603_RS06080 (OR603_06080) 1273262..1273474 + 213 WP_267173076.1 hypothetical protein -
OR603_RS06085 (OR603_06085) 1273532..1273768 + 237 WP_078801815.1 hypothetical protein -
OR603_RS06090 (OR603_06090) 1273781..1274068 + 288 WP_014391452.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1232438..1280259 47821


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(1-97)

Antitoxin

Cro/C1-type helix-turn-helix domain

(47-91)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11763.65 Da        Isoelectric Point: 9.5553

>T264955 WP_078819687.1 NZ_CP112891:c1269911-1269597 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV

Download         Length: 315 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10574.22 Da        Isoelectric Point: 5.7134

>AT264955 WP_078819686.1 NZ_CP112891:c1269600-1269310 [Pasteurella multocida]
MSKKVELKPFDIAEYLDSEEMIAAYLSEILETGDTNEFISALGDVARARGMTELAAKTGLGRESLYKTLSHGSKPRFDTI
MKITQALGIKLVPTHI

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References