Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 4726109..4726688 | Replicon | chromosome |
Accession | NZ_CP112887 | ||
Organism | Raoultella electrica strain S2-IND-01-C |
Toxin (Protein)
Gene name | shpA | Uniprot ID | - |
Locus tag | OR613_RS22860 | Protein ID | WP_131049471.1 |
Coordinates | 4726401..4726688 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | - |
Locus tag | OR613_RS22855 | Protein ID | WP_131049472.1 |
Coordinates | 4726109..4726414 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OR613_RS22845 (OR613_22840) | 4722148..4725414 | + | 3267 | WP_131049474.1 | HsdR family type I site-specific deoxyribonuclease | - |
OR613_RS22850 (OR613_22845) | 4725638..4725973 | + | 336 | WP_131049473.1 | endoribonuclease SymE | - |
OR613_RS22855 (OR613_22850) | 4726109..4726414 | - | 306 | WP_131049472.1 | BrnA antitoxin family protein | Antitoxin |
OR613_RS22860 (OR613_22855) | 4726401..4726688 | - | 288 | WP_131049471.1 | BrnT family toxin | Toxin |
OR613_RS22865 (OR613_22860) | 4727063..4727506 | - | 444 | WP_131049470.1 | FosA family fosfomycin resistance glutathione transferase | - |
OR613_RS22870 (OR613_22865) | 4727500..4728408 | - | 909 | WP_131049469.1 | LysR family transcriptional regulator | - |
OR613_RS22875 (OR613_22870) | 4728496..4729278 | + | 783 | WP_131049468.1 | NAD(P)H-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4714598..4726688 | 12090 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11135.61 Da Isoelectric Point: 8.5787
>T264953 WP_131049471.1 NZ_CP112887:c4726688-4726401 [Raoultella electrica]
MPMEFEWDANKAASNLRKHGIRFEEAVLVFDDPQHLSRQDRYQNGEYRWQTLGLVHGIIVILVAHSVRFESGTEVIRIIS
ARKADKKERSRYEHG
MPMEFEWDANKAASNLRKHGIRFEEAVLVFDDPQHLSRQDRYQNGEYRWQTLGLVHGIIVILVAHSVRFESGTEVIRIIS
ARKADKKERSRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|