Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 4343553..4344196 | Replicon | chromosome |
Accession | NZ_CP112887 | ||
Organism | Raoultella electrica strain S2-IND-01-C |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | - |
Locus tag | OR613_RS21115 | Protein ID | WP_271207263.1 |
Coordinates | 4343891..4344196 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | OR613_RS21110 | Protein ID | WP_165457187.1 |
Coordinates | 4343553..4343870 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OR613_RS21095 (OR613_21095) | 4338971..4341649 | - | 2679 | WP_131049958.1 | DNA repair protein | - |
OR613_RS21100 (OR613_21100) | 4342574..4342990 | + | 417 | Protein_4147 | DUF932 domain-containing protein | - |
OR613_RS21105 (OR613_21105) | 4343061..4343531 | + | 471 | WP_131049960.1 | DNA repair protein RadC | - |
OR613_RS21110 (OR613_21110) | 4343553..4343870 | + | 318 | WP_165457187.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
OR613_RS21115 (OR613_21115) | 4343891..4344196 | + | 306 | WP_271207263.1 | TA system toxin CbtA family protein | Toxin |
OR613_RS21120 (OR613_21120) | 4344230..4345768 | - | 1539 | WP_004181747.1 | IS66 family transposase | - |
OR613_RS21125 (OR613_21125) | 4345818..4346126 | - | 309 | WP_271207637.1 | IS66 family insertion sequence element accessory protein TnpB | - |
OR613_RS21130 (OR613_21130) | 4346123..4347661 | - | 1539 | WP_059593943.1 | IS66-like element ISKpn24 family transposase | - |
OR613_RS21135 (OR613_21135) | 4347710..4348057 | - | 348 | WP_000612626.1 | IS66 family insertion sequence element accessory protein TnpB | - |
OR613_RS21140 (OR613_21140) | 4348054..4348458 | - | 405 | WP_000839182.1 | transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4328131..4350840 | 22709 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11401.13 Da Isoelectric Point: 6.7155
>T264952 WP_271207263.1 NZ_CP112887:4343891-4344196 [Raoultella electrica]
MKTLSATISRAVKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAANFLVDKYELVRIDRRGF
SSQGQEPYLTVTDILHARKAW
MKTLSATISRAVKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAANFLVDKYELVRIDRRGF
SSQGQEPYLTVTDILHARKAW
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|