Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4144152..4144771 | Replicon | chromosome |
Accession | NZ_CP112887 | ||
Organism | Raoultella electrica strain S2-IND-01-C |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A514EV16 |
Locus tag | OR613_RS20165 | Protein ID | WP_004858783.1 |
Coordinates | 4144553..4144771 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A514EV88 |
Locus tag | OR613_RS20160 | Protein ID | WP_004858785.1 |
Coordinates | 4144152..4144526 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OR613_RS20150 (OR613_20150) | 4139264..4140457 | + | 1194 | WP_100683172.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
OR613_RS20155 (OR613_20155) | 4140480..4143626 | + | 3147 | WP_131047523.1 | multidrug efflux RND transporter permease subunit AcrB | - |
OR613_RS20160 (OR613_20160) | 4144152..4144526 | + | 375 | WP_004858785.1 | Hha toxicity modulator TomB | Antitoxin |
OR613_RS20165 (OR613_20165) | 4144553..4144771 | + | 219 | WP_004858783.1 | HHA domain-containing protein | Toxin |
OR613_RS20170 (OR613_20170) | 4144923..4145489 | + | 567 | WP_131047522.1 | maltose O-acetyltransferase | - |
OR613_RS20175 (OR613_20175) | 4145589..4146059 | + | 471 | WP_100683169.1 | YlaC family protein | - |
OR613_RS20180 (OR613_20180) | 4146034..4147479 | - | 1446 | WP_131047521.1 | PLP-dependent aminotransferase family protein | - |
OR613_RS20185 (OR613_20185) | 4147590..4148300 | + | 711 | WP_131047520.1 | GNAT family protein | - |
OR613_RS20190 (OR613_20190) | 4148297..4148437 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
OR613_RS20195 (OR613_20195) | 4148437..4148700 | - | 264 | WP_100683166.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8570.90 Da Isoelectric Point: 7.9907
>T264951 WP_004858783.1 NZ_CP112887:4144553-4144771 [Raoultella electrica]
MSGEPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSGEPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14411.19 Da Isoelectric Point: 4.8989
>AT264951 WP_004858785.1 NZ_CP112887:4144152-4144526 [Raoultella electrica]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYAEDNKLIAQLDEYL
DDTFMLFSSYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYAEDNKLIAQLDEYL
DDTFMLFSSYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A514EV16 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A514EV88 |