Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 2667717..2668468 | Replicon | chromosome |
Accession | NZ_CP112887 | ||
Organism | Raoultella electrica strain S2-IND-01-C |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | OR613_RS13050 | Protein ID | WP_131050355.1 |
Coordinates | 2667986..2668468 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | - |
Locus tag | OR613_RS13045 | Protein ID | WP_100683705.1 |
Coordinates | 2667717..2667995 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OR613_RS13025 (OR613_13030) | 2663085..2664185 | - | 1101 | WP_131050358.1 | amino acid ABC transporter permease | - |
OR613_RS13030 (OR613_13035) | 2664201..2665379 | - | 1179 | WP_131050357.1 | amino acid ABC transporter permease | - |
OR613_RS13035 (OR613_13040) | 2665450..2666475 | - | 1026 | WP_100683707.1 | amino acid ABC transporter substrate-binding protein | - |
OR613_RS13040 (OR613_13045) | 2667035..2667637 | + | 603 | WP_131050356.1 | DJ-1/PfpI family protein | - |
OR613_RS13045 (OR613_13050) | 2667717..2667995 | + | 279 | WP_100683705.1 | DUF1778 domain-containing protein | Antitoxin |
OR613_RS13050 (OR613_13055) | 2667986..2668468 | + | 483 | WP_131050355.1 | GNAT family N-acetyltransferase | Toxin |
OR613_RS13055 (OR613_13060) | 2668519..2669055 | + | 537 | WP_131050354.1 | dihydrofolate reductase family protein | - |
OR613_RS13060 (OR613_13065) | 2669215..2670006 | - | 792 | WP_131050353.1 | tetratricopeptide repeat protein | - |
OR613_RS13065 (OR613_13070) | 2670113..2670559 | - | 447 | Protein_2558 | helix-turn-helix domain-containing protein | - |
OR613_RS13070 (OR613_13075) | 2670605..2671096 | + | 492 | Protein_2559 | DUF637 domain-containing protein | - |
OR613_RS13075 (OR613_13080) | 2671402..2671905 | + | 504 | WP_131050351.1 | Imm70 family immunity protein | - |
OR613_RS13080 (OR613_13085) | 2672166..2672730 | + | 565 | Protein_2561 | SOS response-associated peptidase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17650.46 Da Isoelectric Point: 9.1931
>T264949 WP_131050355.1 NZ_CP112887:2667986-2668468 [Raoultella electrica]
MGMRPPESLTPEHDIAEFCCQDPGLNEWLKKKALKNHSTGISRVYVVCAGNTNRVIAYYCLSSGSVHRNTVPGTFRRNAP
ESVPVIVLGRLAVDVSWAGKGLGAALLKDAIYRTQNIAVQVGVRALLVHALNDEVRDFYTRFGFEPSIVNVLTLLFPIRL
MGMRPPESLTPEHDIAEFCCQDPGLNEWLKKKALKNHSTGISRVYVVCAGNTNRVIAYYCLSSGSVHRNTVPGTFRRNAP
ESVPVIVLGRLAVDVSWAGKGLGAALLKDAIYRTQNIAVQVGVRALLVHALNDEVRDFYTRFGFEPSIVNVLTLLFPIRL
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|