Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 1898815..1899405 | Replicon | chromosome |
Accession | NZ_CP112887 | ||
Organism | Raoultella electrica strain S2-IND-01-C |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | OR613_RS08970 | Protein ID | WP_131050468.1 |
Coordinates | 1899073..1899405 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A3S7DDD0 |
Locus tag | OR613_RS08965 | Protein ID | WP_000288812.1 |
Coordinates | 1898815..1899072 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OR613_RS08950 (OR613_08950) | 1896088..1896228 | - | 141 | WP_160702628.1 | hypothetical protein | - |
OR613_RS08955 (OR613_08955) | 1896970..1898079 | + | 1110 | WP_131050467.1 | dimethyl sulfone monooxygenase SfnG | - |
OR613_RS08960 (OR613_08965) | 1898274..1898465 | + | 192 | WP_131050504.1 | helix-turn-helix domain-containing protein | - |
OR613_RS08965 (OR613_08970) | 1898815..1899072 | + | 258 | WP_000288812.1 | antitoxin | Antitoxin |
OR613_RS08970 (OR613_08975) | 1899073..1899405 | + | 333 | WP_131050468.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OR613_RS08980 (OR613_08985) | 1899642..1900442 | - | 801 | WP_160702622.1 | DgsA anti-repressor MtfA | - |
OR613_RS08990 (OR613_08995) | 1900872..1901036 | + | 165 | Protein_1755 | IS3 family transposase | - |
OR613_RS08995 (OR613_09000) | 1901127..1902197 | - | 1071 | WP_131050765.1 | porin | - |
OR613_RS09000 (OR613_09005) | 1902788..1903069 | + | 282 | WP_100682246.1 | cell division protein DrpB | - |
OR613_RS09005 (OR613_09010) | 1903112..1903807 | + | 696 | WP_131050764.1 | phosphohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11823.72 Da Isoelectric Point: 9.4903
>T264943 WP_131050468.1 NZ_CP112887:1899073-1899405 [Raoultella electrica]
MDRGEIWLVSLDPIAGHEQCGKRPVLIVSQASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEGAGTKTIGVIRCDQPRTI
DMAARNGKRLERIPDAVVNEVLARLDAILS
MDRGEIWLVSLDPIAGHEQCGKRPVLIVSQASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEGAGTKTIGVIRCDQPRTI
DMAARNGKRLERIPDAVVNEVLARLDAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|