Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 817916..818573 | Replicon | chromosome |
| Accession | NZ_CP112887 | ||
| Organism | Raoultella electrica strain S2-IND-01-C | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | OR613_RS04005 | Protein ID | WP_100684294.1 |
| Coordinates | 818163..818573 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A514ELX1 |
| Locus tag | OR613_RS04000 | Protein ID | WP_004867358.1 |
| Coordinates | 817916..818182 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OR613_RS03975 (OR613_03970) | 813057..814490 | - | 1434 | WP_131048602.1 | 6-phospho-beta-glucosidase | - |
| OR613_RS03980 (OR613_03975) | 814610..815338 | - | 729 | WP_131048725.1 | MurR/RpiR family transcriptional regulator | - |
| OR613_RS03985 (OR613_03980) | 815388..815699 | + | 312 | WP_131048603.1 | N(4)-acetylcytidine aminohydrolase | - |
| OR613_RS03990 (OR613_03985) | 815861..816520 | + | 660 | WP_131048604.1 | hemolysin III family protein | - |
| OR613_RS03995 (OR613_03990) | 816636..817619 | - | 984 | WP_131048605.1 | tRNA-modifying protein YgfZ | - |
| OR613_RS04000 (OR613_03995) | 817916..818182 | + | 267 | WP_004867358.1 | FAD assembly factor SdhE | Antitoxin |
| OR613_RS04005 (OR613_04000) | 818163..818573 | + | 411 | WP_100684294.1 | protein YgfX | Toxin |
| OR613_RS04010 (OR613_04005) | 818579..819100 | - | 522 | WP_131048606.1 | flavodoxin FldB | - |
| OR613_RS04015 (OR613_04010) | 819278..820174 | + | 897 | WP_131048607.1 | site-specific tyrosine recombinase XerD | - |
| OR613_RS04020 (OR613_04015) | 820197..820910 | + | 714 | WP_131048608.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| OR613_RS04025 (OR613_04020) | 820916..822649 | + | 1734 | WP_131048609.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16212.09 Da Isoelectric Point: 11.5202
>T264941 WP_100684294.1 NZ_CP112887:818163-818573 [Raoultella electrica]
VVLWQSDLRISWRSQWFSLLLHGVVAAIVLLMPWPLSYTPLWLLLLSLVVFDSVRSQRRIHACRGEIKLMTDSRLRWQKA
EWEIVGTPWVINSGMLLRLQDMQTRRRQHLWVAADSMDAREWRDLRRLVLQKPAQD
VVLWQSDLRISWRSQWFSLLLHGVVAAIVLLMPWPLSYTPLWLLLLSLVVFDSVRSQRRIHACRGEIKLMTDSRLRWQKA
EWEIVGTPWVINSGMLLRLQDMQTRRRQHLWVAADSMDAREWRDLRRLVLQKPAQD
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|