Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 676329..676882 | Replicon | chromosome |
Accession | NZ_CP112887 | ||
Organism | Raoultella electrica strain S2-IND-01-C |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | OR613_RS03285 | Protein ID | WP_100683472.1 |
Coordinates | 676568..676882 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | - |
Locus tag | OR613_RS03280 | Protein ID | WP_100683473.1 |
Coordinates | 676329..676565 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OR613_RS03260 (OR613_03255) | 671781..672359 | + | 579 | WP_131048551.1 | TetR/AcrR family transcriptional regulator | - |
OR613_RS03265 (OR613_03260) | 672360..673394 | - | 1035 | WP_242627883.1 | iron-containing redox enzyme family protein | - |
OR613_RS03270 (OR613_03265) | 673665..674567 | + | 903 | WP_131048553.1 | DMT family transporter | - |
OR613_RS03275 (OR613_03270) | 674609..675766 | + | 1158 | WP_131048554.1 | MFS transporter | - |
OR613_RS03280 (OR613_03275) | 676329..676565 | + | 237 | WP_100683473.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
OR613_RS03285 (OR613_03280) | 676568..676882 | + | 315 | WP_100683472.1 | CcdB family protein | Toxin |
OR613_RS03290 (OR613_03285) | 676879..677031 | - | 153 | Protein_644 | molybdopterin-guanine dinucleotide biosynthesis protein MobC | - |
OR613_RS03295 (OR613_03290) | 677736..678734 | - | 999 | WP_131048555.1 | aldo/keto reductase | - |
OR613_RS03300 (OR613_03295) | 678835..679746 | + | 912 | WP_131048556.1 | LysR family transcriptional regulator | - |
OR613_RS03305 (OR613_03300) | 679960..680124 | - | 165 | Protein_647 | transposase domain-containing protein | - |
OR613_RS03310 (OR613_03305) | 680368..680853 | + | 486 | WP_131048558.1 | MarR family transcriptional regulator | - |
OR613_RS03315 (OR613_03310) | 680882..681727 | + | 846 | WP_131048559.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11475.29 Da Isoelectric Point: 6.4489
>T264940 WP_100683472.1 NZ_CP112887:676568-676882 [Raoultella electrica]
MQFTVYANTGKSTVYPLLLDVTSDIIGQLNRRIVIPLLPVDRYPAGHRPDRLVPFVSLTDGREYAVMTHELASIPVQALG
AVFCDAAQYRSQVKAAIDFLIDGI
MQFTVYANTGKSTVYPLLLDVTSDIIGQLNRRIVIPLLPVDRYPAGHRPDRLVPFVSLTDGREYAVMTHELASIPVQALG
AVFCDAAQYRSQVKAAIDFLIDGI
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|