Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /Xre(antitoxin) |
Location | 290915..292010 | Replicon | chromosome |
Accession | NZ_CP112881 | ||
Organism | Sneathiella aquimaris strain 216LB-ZA1-12 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | OIR97_RS01415 | Protein ID | WP_169543948.1 |
Coordinates | 290915..291664 (-) | Length | 250 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | OIR97_RS01420 | Protein ID | WP_169543949.1 |
Coordinates | 291651..292010 (-) | Length | 120 a.a. |
Genomic Context
Location: 289533..290461 (929 bp)
Type: Others
Protein ID: Protein_277
Type: Others
Protein ID: Protein_277
Location: 295331..295747 (417 bp)
Type: Others
Protein ID: WP_169543953.1
Type: Others
Protein ID: WP_169543953.1
Location: 296414..296896 (483 bp)
Type: Others
Protein ID: WP_169543954.1
Type: Others
Protein ID: WP_169543954.1
Location: 286063..287748 (1686 bp)
Type: Others
Protein ID: WP_169543946.1
Type: Others
Protein ID: WP_169543946.1
Location: 288290..288694 (405 bp)
Type: Others
Protein ID: WP_169543947.1
Type: Others
Protein ID: WP_169543947.1
Location: 289009..289188 (180 bp)
Type: Others
Protein ID: Protein_275
Type: Others
Protein ID: Protein_275
Location: 289227..289539 (313 bp)
Type: Others
Protein ID: Protein_276
Type: Others
Protein ID: Protein_276
Location: 290915..291664 (750 bp)
Type: Toxin
Protein ID: WP_169543948.1
Type: Toxin
Protein ID: WP_169543948.1
Location: 291651..292010 (360 bp)
Type: Antitoxin
Protein ID: WP_169543949.1
Type: Antitoxin
Protein ID: WP_169543949.1
Location: 292884..294272 (1389 bp)
Type: Others
Protein ID: Protein_280
Type: Others
Protein ID: Protein_280
Location: 294311..294541 (231 bp)
Type: Others
Protein ID: WP_169543951.1
Type: Others
Protein ID: WP_169543951.1
Location: 294547..294831 (285 bp)
Type: Others
Protein ID: WP_169543952.1
Type: Others
Protein ID: WP_169543952.1
Location: 294845..295243 (399 bp)
Type: Others
Protein ID: WP_267177761.1
Type: Others
Protein ID: WP_267177761.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OIR97_RS01390 | 286063..287748 | - | 1686 | WP_169543946.1 | methyl-accepting chemotaxis protein | - |
OIR97_RS01395 | 288290..288694 | - | 405 | WP_169543947.1 | LysR family transcriptional regulator | - |
OIR97_RS01400 | 289009..289188 | - | 180 | Protein_275 | IS110 family transposase | - |
OIR97_RS01405 | 289227..289539 | - | 313 | Protein_276 | IS3 family transposase | - |
OIR97_RS01410 | 289533..290461 | + | 929 | Protein_277 | IS3 family transposase | - |
OIR97_RS01415 | 290915..291664 | - | 750 | WP_169543948.1 | RES family NAD+ phosphorylase | Toxin |
OIR97_RS01420 | 291651..292010 | - | 360 | WP_169543949.1 | MbcA/ParS/Xre antitoxin family protein | Antitoxin |
OIR97_RS01425 | 292884..294272 | - | 1389 | Protein_280 | mercury(II) reductase | - |
OIR97_RS01430 | 294311..294541 | - | 231 | WP_169543951.1 | mercury resistance system transport protein MerF | - |
OIR97_RS01435 | 294547..294831 | - | 285 | WP_169543952.1 | mercury resistance system periplasmic binding protein MerP | - |
OIR97_RS01440 | 294845..295243 | - | 399 | WP_267177761.1 | mercuric transporter MerT family protein | - |
OIR97_RS01445 | 295331..295747 | + | 417 | WP_169543953.1 | helix-turn-helix domain-containing protein | - |
OIR97_RS01450 | 296414..296896 | + | 483 | WP_169543954.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 250 a.a. Molecular weight: 28250.36 Da Isoelectric Point: 4.9343
>T264938 WP_169543948.1 NZ_CP112881:c291664-290915 [Sneathiella aquimaris]
VERSEWKEVLSQAQPETLKGLLWRVVEGQSEIATMELVETLDEQMRLEELLDATKPSCPKTAPDDYLLATPFRYPPLKWG
SRFGAQHEMSIFYGSLLKETAAAELTYYRFVFLEGVEEEFPNPMIRASYDLFSVRFKCEHGLDLTKAPFTASTDTLQHKT
NYQPTQALGSELRAAEIQGITYQSARCPKAGLNIAIFEPAGIISKKPVQMLKCYCEATRSRVVLKLDRTQFVEFPRDLFV
IDGNLPEPA
VERSEWKEVLSQAQPETLKGLLWRVVEGQSEIATMELVETLDEQMRLEELLDATKPSCPKTAPDDYLLATPFRYPPLKWG
SRFGAQHEMSIFYGSLLKETAAAELTYYRFVFLEGVEEEFPNPMIRASYDLFSVRFKCEHGLDLTKAPFTASTDTLQHKT
NYQPTQALGSELRAAEIQGITYQSARCPKAGLNIAIFEPAGIISKKPVQMLKCYCEATRSRVVLKLDRTQFVEFPRDLFV
IDGNLPEPA
Download Length: 750 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13086.33 Da Isoelectric Point: 10.5257
>AT264938 WP_169543949.1 NZ_CP112881:c292010-291651 [Sneathiella aquimaris]
MALQQQAIEVDDKAILAKAAKNAASNLGIPLEELAKIIGRDRTAINRGIDPTTKTGELALLFVRCYRALHTLVGGDPKNM
KHWFGTRNKHLNGIPRELIKSVQGLNSVLIYLDGMRGKI
MALQQQAIEVDDKAILAKAAKNAASNLGIPLEELAKIIGRDRTAINRGIDPTTKTGELALLFVRCYRALHTLVGGDPKNM
KHWFGTRNKHLNGIPRELIKSVQGLNSVLIYLDGMRGKI
Download Length: 360 bp