Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 5480016..5480580 | Replicon | chromosome |
Accession | NZ_CP112880 | ||
Organism | Streptomyces sp. CA-278952 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | N7925_RS24520 | Protein ID | WP_265601608.1 |
Coordinates | 5480233..5480580 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | N7925_RS24515 | Protein ID | WP_228182779.1 |
Coordinates | 5480016..5480246 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7925_RS24500 (N7925_24510) | 5475057..5475965 | + | 909 | WP_274345176.1 | LysR family transcriptional regulator | - |
N7925_RS24505 (N7925_24515) | 5476031..5477185 | + | 1155 | WP_274345177.1 | allantoicase | - |
N7925_RS24510 (N7925_24520) | 5477336..5479912 | - | 2577 | WP_265601607.1 | aminopeptidase N | - |
N7925_RS24515 (N7925_24525) | 5480016..5480246 | + | 231 | WP_228182779.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
N7925_RS24520 (N7925_24530) | 5480233..5480580 | + | 348 | WP_265601608.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
N7925_RS24525 (N7925_24535) | 5480653..5481681 | - | 1029 | WP_265601609.1 | aspartate-semialdehyde dehydrogenase | - |
N7925_RS24530 (N7925_24540) | 5481986..5485294 | - | 3309 | WP_265601610.1 | S8 family serine peptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12746.60 Da Isoelectric Point: 10.4132
>T264937 WP_265601608.1 NZ_CP112880:5480233-5480580 [Streptomyces sp. CA-278952]
MRRGDIYLVDYEPVRDSEANKARPSIIVSNDGANAAVDRAGRGVVTVVPLTSNVSRLYPFQVLLQAGDSGLAKDSKVQCE
QVRAMAQERFVRQIGRVPRQRMAEIDAALRRHLAL
MRRGDIYLVDYEPVRDSEANKARPSIIVSNDGANAAVDRAGRGVVTVVPLTSNVSRLYPFQVLLQAGDSGLAKDSKVQCE
QVRAMAQERFVRQIGRVPRQRMAEIDAALRRHLAL
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|