Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 3385445..3385969 | Replicon | chromosome |
Accession | NZ_CP112880 | ||
Organism | Streptomyces sp. CA-278952 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | N7925_RS15045 | Protein ID | WP_274344125.1 |
Coordinates | 3385691..3385969 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | N7925_RS15040 | Protein ID | WP_274344124.1 |
Coordinates | 3385445..3385687 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7925_RS15010 (N7925_15015) | 3380853..3381452 | + | 600 | WP_265600116.1 | TetR/AcrR family transcriptional regulator | - |
N7925_RS15015 (N7925_15020) | 3381523..3381795 | - | 273 | Protein_2981 | hypothetical protein | - |
N7925_RS15020 (N7925_15025) | 3381788..3381958 | + | 171 | Protein_2982 | ABC transporter permease | - |
N7925_RS15025 (N7925_15030) | 3382029..3382931 | - | 903 | WP_265600117.1 | type II CAAX endopeptidase family protein | - |
N7925_RS15030 (N7925_15035) | 3383310..3384095 | + | 786 | WP_274344122.1 | SAM-dependent methyltransferase | - |
N7925_RS15035 (N7925_15040) | 3384068..3385225 | - | 1158 | WP_274344123.1 | hypothetical protein | - |
N7925_RS15040 (N7925_15045) | 3385445..3385687 | + | 243 | WP_274344124.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
N7925_RS15045 (N7925_15050) | 3385691..3385969 | + | 279 | WP_274344125.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N7925_RS15050 (N7925_15055) | 3386160..3386948 | + | 789 | WP_274344126.1 | hypothetical protein | - |
N7925_RS15055 (N7925_15060) | 3387092..3387781 | + | 690 | WP_274344127.1 | HNH endonuclease family protein | - |
N7925_RS15060 (N7925_15065) | 3387811..3388236 | - | 426 | WP_265600122.1 | hypothetical protein | - |
N7925_RS15065 (N7925_15070) | 3388319..3389137 | + | 819 | WP_274344128.1 | helix-turn-helix transcriptional regulator | - |
N7925_RS15070 (N7925_15075) | 3389134..3389373 | + | 240 | WP_274344129.1 | DUF397 domain-containing protein | - |
N7925_RS15075 (N7925_15080) | 3389415..3389592 | + | 178 | Protein_2993 | IS5/IS1182 family transposase | - |
N7925_RS15080 (N7925_15085) | 3389576..3390238 | - | 663 | WP_274344130.1 | HAD-IB family phosphatase | - |
N7925_RS15085 (N7925_15090) | 3390312..3390944 | - | 633 | WP_265600125.1 | DUF1707 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10502.15 Da Isoelectric Point: 11.3382
>T264935 WP_274344125.1 NZ_CP112880:3385691-3385969 [Streptomyces sp. CA-278952]
MGHVTRFTAHAQRDLLKVPLPEARRVLGRLSDLQKALDTGDLSAFDVKPLQGHEARWRLRLGGYRAVYTVEGGRLIVWVL
AVGHQREIYRSR
MGHVTRFTAHAQRDLLKVPLPEARRVLGRLSDLQKALDTGDLSAFDVKPLQGHEARWRLRLGGYRAVYTVEGGRLIVWVL
AVGHQREIYRSR
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|