Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE(toxin) |
Location | 85501..86110 | Replicon | plasmid pPg_03 |
Accession | NZ_CP112877 | ||
Organism | Pseudanabaena galeata CCNP1313 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | OA858_RS25055 | Protein ID | WP_281009943.1 |
Coordinates | 85501..85866 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | OA858_RS25060 | Protein ID | WP_281009944.1 |
Coordinates | 85859..86110 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OA858_RS25030 (OA858_25025) | 81127..81957 | - | 831 | WP_281009938.1 | hypothetical protein | - |
OA858_RS25035 (OA858_25030) | 82198..82587 | + | 390 | WP_281009939.1 | hypothetical protein | - |
OA858_RS25040 (OA858_25035) | 82858..83553 | + | 696 | WP_281009940.1 | hypothetical protein | - |
OA858_RS25045 (OA858_25040) | 83937..85352 | + | 1416 | WP_281009941.1 | tripartite tricarboxylate transporter permease | - |
OA858_RS25050 (OA858_25045) | 85389..85511 | - | 123 | WP_281009942.1 | hypothetical protein | - |
OA858_RS25055 (OA858_25050) | 85501..85866 | - | 366 | WP_281009943.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OA858_RS25060 (OA858_25055) | 85859..86110 | - | 252 | WP_281009944.1 | hypothetical protein | Antitoxin |
OA858_RS25065 (OA858_25060) | 86260..86574 | + | 315 | WP_281009945.1 | hypothetical protein | - |
OA858_RS25070 (OA858_25065) | 86584..87285 | + | 702 | WP_281009946.1 | hypothetical protein | - |
OA858_RS25075 (OA858_25070) | 87282..89528 | + | 2247 | WP_281009948.1 | type I DNA topoisomerase | - |
OA858_RS25080 (OA858_25075) | 89545..89919 | - | 375 | WP_281009533.1 | nuclear transport factor 2 family protein | - |
OA858_RS25085 (OA858_25080) | 90092..90673 | - | 582 | WP_281009534.1 | Uma2 family endonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | katB | 1..174751 | 174751 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13617.52 Da Isoelectric Point: 5.2281
>T264933 WP_281009943.1 NZ_CP112877:c85866-85501 [Pseudanabaena galeata CCNP1313]
MLSENIPISIRFADEFEENLYRLSKRFRNIRKDVVGVIEQIQAGNVVGDRIAGLGENYIVIKVRVKNSNIQKGKSAGYRL
VYQVESPTNVLLLTIYSKSDRDDISAAEILNILSSISVDDE
MLSENIPISIRFADEFEENLYRLSKRFRNIRKDVVGVIEQIQAGNVVGDRIAGLGENYIVIKVRVKNSNIQKGKSAGYRL
VYQVESPTNVLLLTIYSKSDRDDISAAEILNILSSISVDDE
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|