Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/DUF433(antitoxin)
Location 41770..42329 Replicon plasmid pPg_02
Accession NZ_CP112876
Organism Pseudanabaena galeata CCNP1313

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag OA858_RS23810 Protein ID WP_281009758.1
Coordinates 41991..42329 (+) Length 113 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag OA858_RS23805 Protein ID WP_281009757.1
Coordinates 41770..41994 (+) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OA858_RS23775 (OA858_23775) 37475..38536 + 1062 WP_281009753.1 ParB/RepB/Spo0J family partition protein -
OA858_RS23780 (OA858_23780) 38764..39870 + 1107 WP_281009754.1 hypothetical protein -
OA858_RS23785 (OA858_23785) 39983..40390 + 408 WP_190353035.1 hypothetical protein -
OA858_RS23790 (OA858_23790) 40396..40821 + 426 WP_281009755.1 HNH endonuclease -
OA858_RS23795 (OA858_23795) 40842..41165 - 324 WP_281009756.1 XisI protein -
OA858_RS23800 (OA858_23800) 41135..41569 - 435 Protein_53 XisH family protein -
OA858_RS23805 (OA858_23805) 41770..41994 + 225 WP_281009757.1 DUF433 domain-containing protein Antitoxin
OA858_RS23810 (OA858_23810) 41991..42329 + 339 WP_281009758.1 DUF5615 family PIN-like protein Toxin
OA858_RS23815 (OA858_23815) 42508..42852 + 345 Protein_56 type II toxin-antitoxin system RelE/ParE family toxin -
OA858_RS23820 (OA858_23820) 42839..43144 + 306 WP_281009759.1 transcriptional regulator -
OA858_RS23825 (OA858_23825) 43231..43428 + 198 WP_281009760.1 hypothetical protein -
OA858_RS23830 (OA858_23830) 43358..44425 + 1068 WP_281009761.1 PDDEXK nuclease domain-containing protein -
OA858_RS23835 (OA858_23835) 44594..45235 - 642 WP_281009762.1 type I restriction endonuclease subunit R -
OA858_RS23840 (OA858_23840) 45446..45697 + 252 WP_281009763.1 helix-turn-helix domain-containing protein -
OA858_RS23845 (OA858_23845) 45691..47034 + 1344 WP_281009764.1 type II toxin-antitoxin system HipA family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..216652 216652


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Domain of unknown function DUF5615

(1-78)

Antitoxin

Protein of unknown function DUF433

(8-63)


Sequences

Toxin        


Download         Length: 113 a.a.        Molecular weight: 12404.22 Da        Isoelectric Point: 4.1473

>T264930 WP_281009758.1 NZ_CP112876:41991-42329 [Pseudanabaena galeata CCNP1313]
MTIWIDAHLSPAIAPWIYRTFNISAFALRDLGLRDAEDPEIFEAGKAQEIIFMTKDSDFVDLVERLGSPPQIIWLTFGNT
SNAQLKEILTATLPKALEILATGESLVEISGN

Download         Length: 339 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8285.76 Da        Isoelectric Point: 6.9493

>AT264930 WP_281009757.1 NZ_CP112876:41770-41994 [Pseudanabaena galeata CCNP1313]
MPELLKRITINPRQCGGRPCIRGMRIRVSDVLDLFVAGLSAEEILEEMPDLERDDLKAALAYASRKLNHPVLVA

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References