Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacT-ataR/DUF1778(antitoxin) |
Location | 4694699..4695495 | Replicon | chromosome |
Accession | NZ_CP112874 | ||
Organism | Pseudanabaena galeata CCNP1313 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | OA858_RS21465 | Protein ID | WP_281007164.1 |
Coordinates | 4694699..4695208 (-) | Length | 170 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | - |
Locus tag | OA858_RS21470 | Protein ID | WP_281007165.1 |
Coordinates | 4695199..4695495 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OA858_RS21435 (OA858_21435) | 4690129..4690365 | + | 237 | WP_281007159.1 | PQQ-dependent sugar dehydrogenase | - |
OA858_RS21440 (OA858_21440) | 4690623..4690751 | - | 129 | WP_281007160.1 | hypothetical protein | - |
OA858_RS21445 (OA858_21445) | 4690850..4690951 | - | 102 | WP_281009444.1 | DUF1778 domain-containing protein | - |
OA858_RS21450 (OA858_21450) | 4691289..4692833 | - | 1545 | WP_281007161.1 | DNA (cytosine-5-)-methyltransferase | - |
OA858_RS21455 (OA858_21455) | 4692857..4693690 | - | 834 | WP_281007162.1 | TdeIII family type II restriction endonuclease | - |
OA858_RS21460 (OA858_21460) | 4693894..4694502 | + | 609 | WP_281007163.1 | hypothetical protein | - |
OA858_RS21465 (OA858_21465) | 4694699..4695208 | - | 510 | WP_281007164.1 | GNAT family N-acetyltransferase | Toxin |
OA858_RS21470 (OA858_21470) | 4695199..4695495 | - | 297 | WP_281007165.1 | DUF1778 domain-containing protein | Antitoxin |
OA858_RS21475 (OA858_21475) | 4695744..4696001 | - | 258 | WP_281007166.1 | DUF86 domain-containing protein | - |
OA858_RS21480 (OA858_21480) | 4695991..4696314 | - | 324 | WP_281007167.1 | nucleotidyltransferase family protein | - |
OA858_RS21485 (OA858_21485) | 4696427..4697623 | - | 1197 | WP_281007168.1 | hypothetical protein | - |
OA858_RS21490 (OA858_21490) | 4697658..4697861 | - | 204 | WP_281007169.1 | DUF2281 domain-containing protein | - |
OA858_RS21495 (OA858_21495) | 4697876..4699732 | - | 1857 | WP_281007170.1 | N-6 DNA methylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 170 a.a. Molecular weight: 18546.50 Da Isoelectric Point: 9.1820
>T264929 WP_281007164.1 NZ_CP112874:c4695208-4694699 [Pseudanabaena galeata CCNP1313]
VGISLDNLRSPEKLNSSHQIKGFDSGNSQLDDWLKNRAIKNEMEGASRTYVLCADNVVIGFYCLANGSVVQSVATGKVRR
NMPDPIPVMVLGRLAIDRSWQGKGLGRALLRDAILRTLQASEIAGIRAILVHAISENAKVFYEKCGFTASPIDEMTLMIR
IKDAIAIFQ
VGISLDNLRSPEKLNSSHQIKGFDSGNSQLDDWLKNRAIKNEMEGASRTYVLCADNVVIGFYCLANGSVVQSVATGKVRR
NMPDPIPVMVLGRLAIDRSWQGKGLGRALLRDAILRTLQASEIAGIRAILVHAISENAKVFYEKCGFTASPIDEMTLMIR
IKDAIAIFQ
Download Length: 510 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|