Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YoeB-RelB
Location 4402192..4402577 Replicon chromosome
Accession NZ_CP112874
Organism Pseudanabaena galeata CCNP1313

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag OA858_RS20050 Protein ID WP_281006907.1
Coordinates 4402192..4402329 (-) Length 46 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag OA858_RS20055 Protein ID WP_281006908.1
Coordinates 4402326..4402577 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OA858_RS20015 (OA858_20015) 4397545..4398648 - 1104 WP_281006900.1 phospho-N-acetylmuramoyl-pentapeptide- transferase -
OA858_RS20020 (OA858_20020) 4398882..4400231 + 1350 WP_281006901.1 16S rRNA (cytosine(967)-C(5))-methyltransferase -
OA858_RS20025 (OA858_20025) 4400350..4400550 + 201 WP_281006902.1 hypothetical protein -
OA858_RS20030 (OA858_20030) 4400534..4400824 + 291 WP_281006903.1 type II toxin-antitoxin system PemK/MazF family toxin -
OA858_RS20035 (OA858_20035) 4401094..4401450 + 357 WP_281006904.1 hypothetical protein -
OA858_RS20040 (OA858_20040) 4401447..4401587 + 141 WP_281006905.1 hypothetical protein -
OA858_RS20045 (OA858_20045) 4402074..4402181 - 108 WP_281006906.1 type II toxin-antitoxin system YoeB family toxin -
OA858_RS20050 (OA858_20050) 4402192..4402329 - 138 WP_281006907.1 type II toxin-antitoxin system YoeB family toxin Toxin
OA858_RS20055 (OA858_20055) 4402326..4402577 - 252 WP_281006908.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
OA858_RS20060 (OA858_20060) 4402708..4403769 + 1062 WP_281006909.1 IS4 family transposase -
OA858_RS20065 (OA858_20065) 4403942..4404190 + 249 WP_281006910.1 type II toxin-antitoxin system RelE/ParE family toxin -
OA858_RS20070 (OA858_20070) 4404199..4404396 + 198 WP_281006911.1 hypothetical protein -
OA858_RS20075 (OA858_20075) 4404493..4404777 + 285 WP_281006912.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
OA858_RS20080 (OA858_20080) 4404770..4405045 + 276 WP_281006913.1 Txe/YoeB family addiction module toxin -
OA858_RS20085 (OA858_20085) 4405611..4406117 - 507 WP_281006914.1 hypothetical protein -
OA858_RS20090 (OA858_20090) 4406227..4406565 - 339 WP_281006915.1 hypothetical protein -
OA858_RS20095 (OA858_20095) 4406993..4407463 + 471 WP_281006916.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(2-45)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 46 a.a.        Molecular weight: 5444.26 Da        Isoelectric Point: 10.1558

>T264928 WP_281006907.1 NZ_CP112874:c4402329-4402192 [Pseudanabaena galeata CCNP1313]
VKILFSERAWEDYLYWQQTDKKMLNRVNNLIKDIQRNPHSGIGKP

Download         Length: 138 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9444.76 Da        Isoelectric Point: 4.7769

>AT264928 WP_281006908.1 NZ_CP112874:c4402577-4402326 [Pseudanabaena galeata CCNP1313]
MNVISYVDAQRNLAKMIDQVCDRHDPLIITRHQQPSAVLLSLEDYESLTETAYLLKSRNNAKRIFEAIAELESGGVTVRE
LIE

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References