Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 3475138..3475728 | Replicon | chromosome |
| Accession | NZ_CP112874 | ||
| Organism | Pseudanabaena galeata CCNP1313 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | OA858_RS15780 | Protein ID | WP_281009425.1 |
| Coordinates | 3475435..3475728 (-) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | OA858_RS15775 | Protein ID | WP_281006155.1 |
| Coordinates | 3475138..3475431 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OA858_RS15755 (OA858_15750) | 3472381..3473211 | - | 831 | WP_281009424.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| OA858_RS15760 (OA858_15755) | 3473233..3474375 | - | 1143 | WP_281005925.1 | transposase | - |
| OA858_RS15765 (OA858_15760) | 3474462..3474575 | - | 114 | Protein_3124 | PD-(D/E)XK nuclease family transposase | - |
| OA858_RS15770 (OA858_15765) | 3474951..3475145 | + | 195 | WP_281006154.1 | DUF433 domain-containing protein | - |
| OA858_RS15775 (OA858_15770) | 3475138..3475431 | - | 294 | WP_281006155.1 | putative addiction module antidote protein | Antitoxin |
| OA858_RS15780 (OA858_15775) | 3475435..3475728 | - | 294 | WP_281009425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OA858_RS15785 (OA858_15780) | 3475949..3476362 | + | 414 | WP_281006156.1 | hypothetical protein | - |
| OA858_RS15790 (OA858_15785) | 3476408..3478294 | - | 1887 | WP_281006157.1 | AAA family ATPase | - |
| OA858_RS15795 (OA858_15790) | 3478425..3479408 | + | 984 | WP_281006158.1 | IS30 family transposase | - |
| OA858_RS15800 (OA858_15795) | 3479382..3479798 | - | 417 | WP_281006159.1 | hypothetical protein | - |
| OA858_RS15805 (OA858_15800) | 3480162..3480440 | - | 279 | WP_281006160.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3464776..3496424 | 31648 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11071.84 Da Isoelectric Point: 9.8908
>T264926 WP_281009425.1 NZ_CP112874:c3475728-3475435 [Pseudanabaena galeata CCNP1313]
IEVRQTEIFVNWFVKLRDKKAKARIQARIDRMEMGNFGDVAPVGQGVSEMRIFYGTGYRVYFVQRGSILVILLCGGDKST
QTSDINKAKELVKQLED
IEVRQTEIFVNWFVKLRDKKAKARIQARIDRMEMGNFGDVAPVGQGVSEMRIFYGTGYRVYFVQRGSILVILLCGGDKST
QTSDINKAKELVKQLED
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|