Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/Tad-HTH_37 |
Location | 3453410..3454124 | Replicon | chromosome |
Accession | NZ_CP112874 | ||
Organism | Pseudanabaena galeata CCNP1313 |
Toxin (Protein)
Gene name | tad | Uniprot ID | - |
Locus tag | OA858_RS15670 | Protein ID | WP_281006139.1 |
Coordinates | 3453410..3453781 (+) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | - |
Locus tag | OA858_RS15675 | Protein ID | WP_281006140.1 |
Coordinates | 3453795..3454124 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OA858_RS15640 (OA858_15635) | 3449271..3450146 | - | 876 | WP_281006133.1 | alpha/beta fold hydrolase | - |
OA858_RS15645 (OA858_15640) | 3450218..3450955 | - | 738 | WP_281006134.1 | phosphoadenylyl-sulfate reductase | - |
OA858_RS15650 (OA858_15645) | 3451153..3451884 | - | 732 | WP_281006135.1 | NUDIX domain-containing protein | - |
OA858_RS15655 (OA858_15650) | 3451860..3452447 | - | 588 | WP_281006136.1 | nicotinate-nucleotide adenylyltransferase | - |
OA858_RS15660 (OA858_15655) | 3452701..3452997 | + | 297 | WP_281006137.1 | hypothetical protein | - |
OA858_RS15665 (OA858_15660) | 3452997..3453266 | + | 270 | WP_281006138.1 | PIN domain-containing protein | - |
OA858_RS15670 (OA858_15665) | 3453410..3453781 | + | 372 | WP_281006139.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OA858_RS15675 (OA858_15670) | 3453795..3454124 | + | 330 | WP_281006140.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OA858_RS15680 (OA858_15675) | 3454313..3454543 | + | 231 | WP_281006141.1 | hypothetical protein | - |
OA858_RS15685 (OA858_15680) | 3454533..3454940 | + | 408 | WP_281006142.1 | DUF6516 family protein | - |
OA858_RS15690 (OA858_15685) | 3455016..3455255 | - | 240 | WP_281006143.1 | DUF2281 domain-containing protein | - |
OA858_RS15695 (OA858_15690) | 3455274..3455882 | - | 609 | WP_281006144.1 | hypothetical protein | - |
OA858_RS15700 (OA858_15695) | 3455916..3457019 | - | 1104 | WP_281006145.1 | ImmA/IrrE family metallo-endopeptidase | - |
OA858_RS15705 (OA858_15700) | 3457012..3457314 | - | 303 | WP_281006146.1 | killer suppression protein HigA | - |
OA858_RS15710 (OA858_15705) | 3458036..3458350 | + | 315 | WP_281006147.1 | hypothetical protein | - |
OA858_RS15715 (OA858_15710) | 3458325..3458705 | + | 381 | WP_281006148.1 | DUF6516 family protein | - |
OA858_RS15720 (OA858_15715) | 3458815..3458961 | - | 147 | WP_281006149.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13921.93 Da Isoelectric Point: 8.0349
>T264925 WP_281006139.1 NZ_CP112874:3453410-3453781 [Pseudanabaena galeata CCNP1313]
VSSLFLKPVEWIGSSLDDLKDFPNEVQQVVGYALYIAQCGDKHPIAKPLKGFKGAGVVEVVDDFDGDTYRAVYTIKFADV
VYVLHSFQKKSKQGIATPKQDMDLIEARLKRAKEHYSEHYNKK
VSSLFLKPVEWIGSSLDDLKDFPNEVQQVVGYALYIAQCGDKHPIAKPLKGFKGAGVVEVVDDFDGDTYRAVYTIKFADV
VYVLHSFQKKSKQGIATPKQDMDLIEARLKRAKEHYSEHYNKK
Download Length: 372 bp
Antitoxin
Download Length: 110 a.a. Molecular weight: 12036.99 Da Isoelectric Point: 10.2427
>AT264925 WP_281006140.1 NZ_CP112874:3453795-3454124 [Pseudanabaena galeata CCNP1313]
MTEEIKVQKSSGNVFADLGLENSDELLVKAELAYKISSIITKLEITQVEAAKLLGIDQPKMSALLNGKLSGFSTVRLFRF
LNSLGRDVEIVVKDKPKSRSQARTQVVSR
MTEEIKVQKSSGNVFADLGLENSDELLVKAELAYKISSIITKLEITQVEAAKLLGIDQPKMSALLNGKLSGFSTVRLFRF
LNSLGRDVEIVVKDKPKSRSQARTQVVSR
Download Length: 330 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|