Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 3410190..3410817 | Replicon | chromosome |
| Accession | NZ_CP112874 | ||
| Organism | Pseudanabaena galeata CCNP1313 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | OA858_RS15450 | Protein ID | WP_281006097.1 |
| Coordinates | 3410190..3410609 (-) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | OA858_RS15455 | Protein ID | WP_281006098.1 |
| Coordinates | 3410599..3410817 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OA858_RS15430 (OA858_15425) | 3407029..3408765 | + | 1737 | WP_281006093.1 | EAL domain-containing protein | - |
| OA858_RS15435 (OA858_15430) | 3409194..3409598 | - | 405 | WP_281006094.1 | DUF6516 family protein | - |
| OA858_RS15440 (OA858_15435) | 3409588..3409908 | - | 321 | WP_281006095.1 | hypothetical protein | - |
| OA858_RS15445 (OA858_15440) | 3410028..3410162 | + | 135 | WP_281006096.1 | hypothetical protein | - |
| OA858_RS15450 (OA858_15445) | 3410190..3410609 | - | 420 | WP_281006097.1 | putative toxin-antitoxin system toxin component, PIN family | Toxin |
| OA858_RS15455 (OA858_15450) | 3410599..3410817 | - | 219 | WP_281006098.1 | hypothetical protein | Antitoxin |
| OA858_RS15460 (OA858_15455) | 3410804..3411031 | + | 228 | WP_281006099.1 | hypothetical protein | - |
| OA858_RS15465 (OA858_15460) | 3411133..3411381 | + | 249 | WP_281006100.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| OA858_RS15470 (OA858_15465) | 3411381..3411593 | + | 213 | WP_281006101.1 | type II toxin-antitoxin system HicA family toxin | - |
| OA858_RS15475 (OA858_15470) | 3411774..3413243 | - | 1470 | WP_281006102.1 | EH signature domain-containing protein | - |
| OA858_RS15480 (OA858_15475) | 3413240..3413935 | - | 696 | WP_281006103.1 | OmpA family protein | - |
| OA858_RS15485 (OA858_15480) | 3413939..3415753 | - | 1815 | WP_281006104.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15838.39 Da Isoelectric Point: 4.7195
>T264924 WP_281006097.1 NZ_CP112874:c3410609-3410190 [Pseudanabaena galeata CCNP1313]
MQGNPLRLVIDTNIWISFLIGKSLTGLSQAIISDQVIVLFSDDLFGELIKVLKRPKFKKYFSETAIEDLVTLLYEKVELI
EITHHFEDCRDAKDNFLLDLAVSGHANYLVTGDADLLILNPFQGVEIISYQHFQNLILK
MQGNPLRLVIDTNIWISFLIGKSLTGLSQAIISDQVIVLFSDDLFGELIKVLKRPKFKKYFSETAIEDLVTLLYEKVELI
EITHHFEDCRDAKDNFLLDLAVSGHANYLVTGDADLLILNPFQGVEIISYQHFQNLILK
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|