Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/DUF433(antitoxin) |
| Location | 2085967..2086538 | Replicon | chromosome |
| Accession | NZ_CP112874 | ||
| Organism | Pseudanabaena galeata CCNP1313 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | OA858_RS09510 | Protein ID | WP_281009053.1 |
| Coordinates | 2085967..2086308 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | OA858_RS09515 | Protein ID | WP_169361944.1 |
| Coordinates | 2086305..2086538 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OA858_RS09505 (OA858_09500) | 2081726..2085703 | + | 3978 | WP_281009052.1 | DNA-directed RNA polymerase subunit beta' | - |
| OA858_RS09510 (OA858_09505) | 2085967..2086308 | - | 342 | WP_281009053.1 | DUF5615 family PIN-like protein | Toxin |
| OA858_RS09515 (OA858_09510) | 2086305..2086538 | - | 234 | WP_169361944.1 | DUF433 domain-containing protein | Antitoxin |
| OA858_RS09520 (OA858_09515) | 2086662..2087120 | + | 459 | WP_281009054.1 | DUF29 domain-containing protein | - |
| OA858_RS09525 (OA858_09520) | 2087646..2088668 | + | 1023 | WP_281009055.1 | oxygen-dependent coproporphyrinogen oxidase | - |
| OA858_RS09530 (OA858_09525) | 2088831..2089814 | + | 984 | WP_281009056.1 | IS30 family transposase | - |
| OA858_RS09535 (OA858_09530) | 2090214..2090864 | + | 651 | WP_281009393.1 | DUF2079 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12664.61 Da Isoelectric Point: 4.2821
>T264921 WP_281009053.1 NZ_CP112874:c2086308-2085967 [Pseudanabaena galeata CCNP1313]
MIIWIDAQLPPALANWINSNFDVEAMSLKYLSLRDAKDIEIFEAARFANVVIMTKDSDFIDLVCRLGSPPRILWLTCGNV
SNRNLQRLLTATLAEALSQLEQGEVIVEISNNS
MIIWIDAQLPPALANWINSNFDVEAMSLKYLSLRDAKDIEIFEAARFANVVIMTKDSDFIDLVCRLGSPPRILWLTCGNV
SNRNLQRLLTATLAEALSQLEQGEVIVEISNNS
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|