Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 549422..550007 | Replicon | chromosome |
| Accession | NZ_CP112874 | ||
| Organism | Pseudanabaena galeata CCNP1313 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | OA858_RS02455 | Protein ID | WP_281007778.1 |
| Coordinates | 549422..549790 (-) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | OA858_RS02460 | Protein ID | WP_281007779.1 |
| Coordinates | 549783..550007 (-) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OA858_RS02430 (OA858_02425) | 545923..546570 | + | 648 | WP_281007774.1 | NUDIX hydrolase | - |
| OA858_RS02435 (OA858_02430) | 546558..546692 | + | 135 | WP_281007775.1 | hypothetical protein | - |
| OA858_RS02440 (OA858_02435) | 546907..547041 | - | 135 | WP_281007776.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| OA858_RS02445 (OA858_02440) | 547138..548199 | - | 1062 | WP_281006032.1 | IS4 family transposase | - |
| OA858_RS02450 (OA858_02445) | 548321..549142 | - | 822 | WP_281007777.1 | Uma2 family endonuclease | - |
| OA858_RS02455 (OA858_02450) | 549422..549790 | - | 369 | WP_281007778.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| OA858_RS02460 (OA858_02455) | 549783..550007 | - | 225 | WP_281007779.1 | hypothetical protein | Antitoxin |
| OA858_RS02465 (OA858_02460) | 550333..550584 | + | 252 | WP_281007780.1 | hypothetical protein | - |
| OA858_RS02470 (OA858_02465) | 550751..550972 | + | 222 | WP_281007781.1 | DUF433 domain-containing protein | - |
| OA858_RS02475 (OA858_02470) | 550976..551293 | + | 318 | WP_281007782.1 | hypothetical protein | - |
| OA858_RS02480 (OA858_02475) | 551744..552574 | + | 831 | WP_281007783.1 | hypothetical protein | - |
| OA858_RS02485 (OA858_02480) | 552698..553435 | - | 738 | WP_281007784.1 | Uma2 family endonuclease | - |
| OA858_RS02490 (OA858_02485) | 553666..554460 | - | 795 | WP_281007785.1 | Uma2 family endonuclease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13648.71 Da Isoelectric Point: 9.5275
>T264920 WP_281007778.1 NZ_CP112874:c549790-549422 [Pseudanabaena galeata CCNP1313]
MPNGTLTYKRGEIWWVDLNPIVGSETGKERPCLILQNDIGNQNGLTTIVAPLLPNKKTYPFVVNVIPTPKNGLSGDRHIN
LSQMRAVDARRIKNKQGVLEDIYWKEIAKAVSIELGFNDFSS
MPNGTLTYKRGEIWWVDLNPIVGSETGKERPCLILQNDIGNQNGLTTIVAPLLPNKKTYPFVVNVIPTPKNGLSGDRHIN
LSQMRAVDARRIKNKQGVLEDIYWKEIAKAVSIELGFNDFSS
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|