Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1350250..1351166 | Replicon | chromosome |
Accession | NZ_CP112873 | ||
Organism | Bacillus subtilis strain O4 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | ORF34_RS07120 | Protein ID | WP_003244695.1 |
Coordinates | 1350420..1351166 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | ORF34_RS07115 | Protein ID | WP_003232646.1 |
Coordinates | 1350250..1350420 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORF34_RS07080 (1347113) | 1347113..1347442 | + | 330 | WP_003232660.1 | XkdW family protein | - |
ORF34_RS07085 (1347439) | 1347439..1347603 | + | 165 | WP_003232658.1 | XkdX family protein | - |
ORF34_RS07090 (1347647) | 1347647..1348486 | + | 840 | WP_003245597.1 | phage-like element PBSX protein XepA | - |
ORF34_RS07095 (1348539) | 1348539..1348808 | + | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
ORF34_RS07100 (1348821) | 1348821..1349084 | + | 264 | WP_003232653.1 | phage holin | - |
ORF34_RS07105 (1349097) | 1349097..1349990 | + | 894 | WP_003245230.1 | N-acetylmuramoyl-L-alanine amidase | - |
ORF34_RS07110 (1350027) | 1350027..1350164 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
ORF34_RS07115 (1350250) | 1350250..1350420 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
ORF34_RS07120 (1350420) | 1350420..1351166 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
ORF34_RS07125 (1351276) | 1351276..1352277 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
ORF34_RS07130 (1352290) | 1352290..1352907 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
ORF34_RS07135 (1353183) | 1353183..1354499 | - | 1317 | WP_003244819.1 | serine/threonine exchanger | - |
ORF34_RS07140 (1354888) | 1354888..1355838 | + | 951 | WP_003245086.1 | ring-cleaving dioxygenase | - |
ORF34_RS07145 (1355939) | 1355939..1356085 | + | 147 | WP_003244977.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T264900 WP_003244695.1 NZ_CP112873:c1351166-1350420 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|